Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Certification of Contract with Haber & Son's Plumbing, Inc.
yaw MIAMI BEACH C 2 D CITY OF MIAMI BEACH /g i 7 CERTIFICATION OF CONTRACT TITLE: For Plumbing Services CONTRACT NO.: ITB 2017-039-JC EFFECTIVE DATE(S): This Contract shall remain in effect for a period of three (3) years from the effective date of February 24th, 2017, and may be extended at the sole discretion of the City of Miami Beach, though its City Manager, for two (2) additional one (1) year terms. SUPERSEDES: N/A CONTRACTOR(S): Haber & Son's Plumbing, Inc. (Secondary Vendor) ESTIMATED ANNUAL CONTRACT AMOUNT: $ 201,500.00 A. AUTHORITY- Upon affirmative action taken on February 8, 2017, by the Mayor and City Commission of the City of Miami Beach, Florida ("City"), approving the award of this Contract, and upon execution thereof by the City and Haber & Son's Plumbing, Inc., a Florida corporation (the "Contractor"). B. EFFECT - This Contract is entered into to provide for Plumbing Services, pursuant to City Invitation to Bid No. 2017-039-JC and any addenda thereto (the ITB), and Contractor's bid in response thereto (this Contract, the ITB, and Contractor's bid in response thereto may hereinafter collectively be referred to as the "Contract Documents"). C. ORDERING INSTRUCTIONS - All blanket purchase orders shall be issued in accordance with the City of Miami Beach Department of Procurement Management policies and procedures, at the prices indicated, exclusive of all Federal, State and local taxes. All blanket purchase orders shall show the City of Miami Beach Contract Number ITB 2017-039-JC. D. CONTRACTOR PERFORMANCE - City of Miami Beach departments shall report any failure of Contractor's performance (or failure to perform) according to the requirements of the Contract Documents to City of Miami Beach, Adrian Morales-Property Management Division Director - Property Management Department at 305-673-7000 ext. 2932.. E. INSURANCE CERTIFICATE(S) - The Contractor shall file Insurance Certificates, as required, which must be signed by a Registered Insurance Agent licensed in the State of Florida, and approved by the City of Miami Beach Risk Manager, prior to delivery of supplies and/or commencement of any services/work by Contractor. F. ASSIGNMENT AND PERFORMANCE - Neither this Contract nor any interest herein shall be assigned, transferred, or encumbered by Contractor without the prior written consent of the City. In addition, Contractor shall not subcontract delivery of supplies, or 1 Page 2 Certification of Contract any portion of work and/or services required by the Contract Documents without the prior written consent of the City. Contractor warrants and represents that all persons providing/performing any supplies, work, and/or services required by the Contract Documents have the knowledge and skills, either by training, experience, education, or a combination thereof, to adequately and competently provide/perform same, or services to City's satisfaction, for the agreed compensation. Contractor shall provide/perform the supplies, work, and/or services required under the Contract Documents in a skillful and respectable manner. The quality of the Contractor's performance and all interim and final product(s) and /or work provided to or on behalf of City shall be comparable to the best local and national standards. G. SERVICE EXCELLENCE STANDARDS — Excellent Customer Service is the standard of the City of Miami Beach. As a Contractor of the City, Contractor will be required to conduct itself in a professional, courteous and ethical manner, and at all times adhere to the City's Service Excellence standards. Training will be provided by the City's Organizational Development and Training Specialist. H. PUBLIC ENTITY CRIMES — Contractor acknowledges that the provision of the Public Entity Crimes Act, Section 287.133, Florida Statutes, shall apply to this Contract, which statute, among other things, provides that a person or affiliate who is a contractor, consultant or other provider, who has been placed on the convicted vendor list following a conviction for a public entity crime may not submit a bid on a contract to provide any goods or services to the City, may not submit a bid on a contract with the City for the construction or repair of a public building or public work, may not submit bids on leases of real property to the City, may not be awarded or perform work as a contractor, supplier, subcontractor, or consultant under a contract with the City, and may not transact any business with the City in excess of the threshold amount provided in Section 287.017, Florida Statutes, for category two purchases for a period of 36 months from the date of being placed on the convicted vendor list. Violation of this section by Contractor shall result in cancellation of the Contract and may result in Contractor debarment. INDEPENDENT CONTRACTOR - Contractor is an independent contractor under this Contract. Supplies, work, and/or services, provided by Contractor pursuant to the Contract Documents shall be subject to the supervision of Contractor. In providing such supplies, work, and/or services, neither Contractor nor its agents shall act as officers, employees, or agents of the City. This Contract shall not constitute or make the parties a partnership or joint venture. J. THIRD PARTY BENEFICIARIES - Neither Contractor nor City intends to directly or substantially benefit a third party by this Contract and/or the Contract Documents. Therefore, the parties agree that there are no third party beneficiaries to this Contract and that no third party shall be entitled to assert a claim against either of them based upon this Contract and/or the Contract Documents. The parties expressly acknowledge that it is not their intent to create any rights or obligations in any third person or entity under this Contract and/or the Contract Documents. 2 Page 3 Certification of Contract K. NOTICES - Whenever either party desires to give notice to the other, such notice must be in writing, sent by certified United States Mail, postage prepaid, return receipt requested, or by hand-delivery with a request for a written receipt of acknowledgment of delivery, addressed to the party for whom it is intended at the place last specified. The place for giving notice shall remain the same as set forth herein until changed in writing in the manner provided in this section. For the present, the parties designate the following: For City: Alex Denis, Procurement Director City of Miami Beach Department of Procurement Management 1755 Meridian Avenue, 3rd Floor Miami Beach, Florida 33139 With copies to: City Clerk City Clerk Office 1700 Convention Center Drive Miami Beach, Florida 33139 For Contractor: Haber & Son's Plumbing, Inc. 4106 NW 37 Avenue Miami, FL. 33142 Attn: Jose Haber Phone: 305-461-8653 Fax: 305-567-9976 E-mail: Ha berandplumbingabellsouth.net L. MATERIALITY AND WAIVER OF BREACH - City and Contractor agree that each requirement, duty, and obligation set forth in the Contract Documents is substantial and important to the formation of this Contract and, therefore, is a material term hereof. City's failure to enforce any provision of the Contract Documents shall not be deemed a waiver of such provision or modification of this Contract. A waiver of any breach of a provision of this Contract shall not be deemed a waiver of any subsequent breach and shall not be construed to be a modification of the terms of this Contract. M. SEVERANCE - In the event a portion of this Contract and/or the Contract Documents is found by a court of competent jurisdiction to be invalid, the remaining provisions shall continue to be effective unless City or Contractor elects to terminate this Contract. An election to terminate this Contract based upon this provision shall be made within seven (7) days after the finding by the court becomes final. 3 Page 4 Certification of Contract N. APPLICABLE LAW AND VENUE - This Contract and/or the Contract Documents shall be enforceable in Miami-Dade County, Florida, and if legal action is necessary by either party with respect to the enforcement of any or all of the terms or conditions herein exclusive venue for the enforcement of same shall lie in Miami-Dade County, Florida. By entering into this Contract, Contractor and City hereby expressly waive any rights either party may have to a trial by jury of any civil litigation related to, or arising out of the Contract and/or the Contract Documents. Contractor, shall specifically bind all subcontractors to the provisions of this Contract and the Contract Documents. 0. AMENDMENTS - No modification, amendment, or alteration in the terms or conditions contained herein, or in the Contract Documents, shall be effective unless contained in a written document prepared with the same or similar formality as this Contract and executed by the City and Contractor. P. This Contract shall not be effective until all bonds and insurance(s) required under the Contract Documents have been submitted to, and approved by, the City's Risk Manager. Q. The ITB and Contractor's bid in response thereto, are attached to this Contract and are hereby adopted by reference and incorporated herein as if fully set forth in this Contract. Accordingly, Contractor agrees to abide by and be bound by any and all of the documents incorporated by the Contract Documents. Where there is a conflict between any provision set forth within (i) this Contract; (ii) the ITB; and /or (iii) Contractor's bid in response thereto, the more stringent provision (as enforced by the City) shall prevail. 4 Page 5 Certification of Contract IN WITNESS WHEREOF the City and Contractor have caused this Certification of Contract to be signed and attested on this 1+11 day of Msid- , 20 (7 , by their respective duly authorized representatives. HABER & SON'S PLUMBING, INC CITY OF MIAMI BE H, FLORIDA / By By Presi•en Signa ure P ip _ `ine, Mayor = bS �63� ►Z Print Name Date 3 1 - 3t' %1 Date ATTEST: ATTEST: Secretary/ Signature Rafael E. Granado, City Clerk g/caiid Xte• ,r.-)c✓e- Print Name d' to 1_I .ZD/ AS APPROVED "f0 Date FO. M & lANUUACiE $ POP EXECUTON L \ ' y7 City Attorney R Q Date 5 ATTACHMENT A RESOLUTION COMMISSION ITEMS AND COMMISSION MEMORANDUM MIAMI BEACH City of Miami Beach, 1700 Convention Center Drive,Miami Beach,Florida 33139,www.miamibeachfl.gov COMMISSION MEMORANDUM TO: Mayor Philip Levine and Members of the City Commission FROM: Jimmy L. Morales, City Manager DATE: FEBRUARY 8, 2017 SUBJECT: INVIITATIIONQUEST OTO BID(IR RB)NO.2017-039-JCOVAL TO DCONTRACT FOR PLUMBING SERVICES. KEY INTENDED OUTCOME Build and Maintain Priority Infrastructure with Full Accountability. FUNDING to All expenditures pursuant to this contract will be based on approved funding appropriated the respective department's budget. Grant funding will not be utilized for this project. BACKGROUND INFORMATION The purpose of this bid is to establish an agreement, by means of sealed bids,to a qualified plumbing contractor(s)in order to provide the City with various routine plumbing services on a time-and-materials basis, including parts, labor,materials,equipment and supervision;on an"as-needed"basis for emergency and non-emergency repairs;or,participate in a pool of prequalified plumbing contractors for non-emergency or planned repairs and projects. ITB PROCESS ITB No. 2017-039-JC, was issued on November 17, 2016, with a bid opening date of December 27, 2016. The Procurement Department issued bid notices to one hundred seventy-three(173)companies utilizing www.publicpurchase.com website, and thirty-three (33)companies via email notification. Twenty-three(23) prospective bidders accessed the advertised solicitation. There were no addenda issued pursuant to the ITB. The notices resulted in the receipt of two(2)bids from: Pipeline Plumbing Services of Broward, Inc.,and Haber&Son's, Inc. Both bids were deemed to be responsive to the requirements of the ITB. The bid tabulation sheet is attached (Attachment A). The ITB stated that the lowest responsive, responsible bidder meeting all terms,conditions, and specifications of the ITB will be recommended for award. In its due diligence, the Procurement Department verified that the lowest bidder, Pipeline Plumbing Services of Broward, Inc., has met the requirements of the ITB, and the second lowest bidder, Haber and Son's, Inc., has also met the terms, conditions and specifications of the ITB, including: 1. Minimum Requirements: Bidder(firm) must be certified as plumbing contractor by Miami-Dade County. Both Pipeline Plumbing Services of Broward, Inc., and Haber and Son's, Inc., met the minimum eligibility requirements set for this solicitation. Accordingly,for Group 1:Time and Materials Basis, Pipeline Plumbing Services of Broward, Commission Memorandum ITB 2017-039-JC Plumbing Services February 8,2017 Page 12 Inc., has been deemed the primary lowest responsive bidder,and Haber and Son's Inc.,has been deemed the secondary lowest responsive bidder, meeting all terms, conditions, and specifications of the ITB. For Group 2: Pool of Prequalified Contractors, only Pipeline Plumbing Services of Broward, Inc., responded wishing to participate in the pool of prequalified contractors. Since it is understood that one(1)bidder does not constitute a pool of prequalified contractors,the Administration,therefore,will not consider recommending an award for Group 2. Pipeline Plumbing Services of Broward, Inc., is the City's incumbent plumbing contractor, serving the City of Miami Beach for the last three(3)years. Additionally, Pipeline Plumbing Services of Broward, Inc., has current plumbing contracts with other regional agencies including, the City of Fort Lauderdale, the City of Sunrise, and the City of Pompano Beach. Haber and Son's, Inc., is a Miami-Dade County plumbing and general contractor, and certified as a Small Business Enterprise Construction Services(SBE/CONS)through Miami- Dade County Small Business Development(SBD). Haber and Son's, Inc., has professional plumbing experience servicing the City of Miami Beach, Miami-Dade County and various commercial clients over the past eighteen (18) years. CITY MANAGER'S REVIEW AND RECOMMENDATION After considering the bids received and the evaluation of bids by staff,the Administration is recommending award to a primary and secondary bidder as follows: for Group 1: Pipeline Plumbing Services of Broward, Inc.,as the primary lowest responsive bidder,and Haber and Son's, Inc.,as the secondary lowest responsive bidder,and further authorize the Mayor and City Clerk to execute the contract. CONCLUSION The Administration recommends that the Mayor and City Commission of the City of Miami Beach, Florida approve the City Manager's recommendation pertaining to the bids received, pursuant to 2017-039-JC for Plumbing Services, by awarding to a primary and secondary bidder as follows: for Group 1: Pipeline Plumbing Services of Broward, Inc., as the primary lowest responsive bidder, and Haber and Son's, Inc., as the secondary lowest responsive bidder, and further authorize the Mayor and City Clerk to execute the contract. Commission Memorandum ITB 2017-039-JC Plumbing Services February 8,2017 Page 13 Attachment A .GROUP I:TIME AND MATERIAl�BA 5. : �_ : pit Totat O tuan tem Description r U I M UnitCo ISttiCost Total n ity_kUnitt_Cost) EQUIPMENT,PARTS AND SERVE Al Hoon•Rate-Rea ar 1600 lic~,'y Rat:.3 03 00 5 100 '))90 $ 55.0t) S A2 h r,Rate-Ficfl Rei'ar Ci; iioxy Rate S 53)2 3 25,2)3.00 3 97.50 S 39.,30;r) SUBTOTAL-LABOR S 1230+})90 SIB-TOTAL-LABOR S 1=3.01,)"x) Esiinra f % -up Net Cost. % k-up Net Cost , itesc t •• AnnualGrass �I ' _ {Daterint Cost �b �Cos�@eat� � xpr, xss3.1) � C�E,�.:44ark. � � Woad) kivo Ce c upt , 3�J7. ] A3 Adria � 7ehar��A`crPar 55000) 375'w 3 437530 17�x,o S SUB-TOTAL-PARTS&EQUFMENT $ 54,37500 tB.TOTAL-PARTS&EQUIPIfIT,$ 58.500 0.3 GRANDTOTAL(ITEMSA A3 S 120.375.37 GRAND'TOTAL(ITEMSA1-A3}3 201,500.3+) GROUP 2: POOL OF PREQUALIFIED CONTRACTORS Does bidder wish to be considered for Pool of Prequai`ied Contractors(See Appendix C.Section 4.3)7 Yes_Pipeline No_Haber&Sons stA be?Cc^iFv'res,C.',s'&3rn;Iesccr 5x,e Nner'C u2 Gtl+E*�:a y"d'?"i�3x r,Pcci c;Prey e'er ATTACHMENT B INVITATION TO BID (ITB) AND ADDENDUMS MIAMI BEACH INVITATION TO BID (ITB) PLUMBING SERVICES 2017-039-JC BID ISSUANCE DATE: NOVEMBER 17, 2016 BID DUE: JANUARY 6, 2017 @ 3:00 PM ISSUED BY: t ► MIAMIBEACH JASON CROUCH, PROCUREMENT CONTRACTING OFFICER PROCUREMENT DEPARTMENT 1755 Meridian Ave.3td Floor, Miami Beach, FL 33139 305.673.7000, x66941 www.miamibeachfl.gov m MIAMI BEACH TABLE OF CONTENTS SOLICITATION SECTIONS: PAGE 0100 NOT UTILIZED N/A 0200 INSTRUCTIONS TO BIDDERS & GENERAL CONDITIONS 3 0300 BID SUBMITTAL INSTRUCTIONS & FORMAT 15 APPENDICES: APPENDIX A PROPOSAL CERTIFICATON, QUESTIONNAIRE AND AFFIDAVITS APPENDIX B "NO BID" FORM APPENDIX C MINIMUM REQUIREMENTS & SPECIFICATIONS APPENDIX D SPECIAL CONDITIONS APPENDIX E COST PROPOSAL FORM APPENDIX F INSURANCE REQUIREMENTS ITB 2017-039-IC 2 m► MIAMI BEACH SECTION 0200 INSTRUCTIONS TO BIDDERS 1.GENERAL. This Invitation to Bid (ITB) is issued by the City of Miami Beach, Florida (the "City"), as the means for prospective Proposers to submit their qualifications, proposed scopes of work and cost proposals (the "bid") to the City for the City's consideration as an option in achieving the required scope of services and requirements as noted herein. All documents released in connection with this solicitation, including all appendixes and addenda, whether included herein or released under separate cover, comprise the solicitation, and are complementary to one another and together establish the complete terms,conditions and obligations of the Proposers and, subsequently,the successful Bidders(s) (the"contractor[s]") if this ITB results in an award. The City utilizes PublicPurchase (www.publicpurchase.com) for automatic notification of competitive solicitation opportunities and document fulfillment, including the issuance of any addendum to this ITB. Any prospective Bidder who has received this ITB by any means other than through PublicPurchase must register immediately with PublicPurchase to assure it receives any addendum issued to this ITB. Failure to receive an addendum may result in disqualification of proposal submitted. 2. PURPOSE. The City is seeking bids from qualified plumbing contractors to: 1) provide the City with various routine plumbing services on a time and materials basis, including parts, labor, materials, equipment and supervision on an "as needed" basis, including emergency repairs; or 2) participate in a pool of prequalified plumbing contractors for non- emergency or planned repairs and projects. The requirements and specifications are further detailed herein and, especially, in Appendix C. This ITB, and all subsequent work awarded pursuant to the ITB, shall comply with the City's Living Wage Law, as stipulated in the Code of the City of Miami Beach, Florida, Chapter 2, Article VI, Division 6, Sections 2-407—2-410. 3.SOLICITATION TIMETABLE.The tentative schedule for this solicitation is as follows: ITB Issued November 17,2016 Pre-Bid Meeting December 6,2016 @ 11 a.m. (EST) Deadline for Receipt of Questions December 27,2016 Responses Due January 6,2017 @ 3:00 p.m. (EST) Tentative Commission Approval Authorizing Award TBD 4. PROCUREMENT CONTACT. Any questions or clarifications concerning this solicitation shall be submitted to the Procurement Contact noted below: Procurement Contact Telephone: Email: Jason Crouch 305-673-7000, Ext.6694 'asoncrouch• miamibeachfl.•ov dditionally. the City Clerk is to be copied on all communications via e-mail at: RafaelGranado(a miamibeachfl.gov; or via facsimile: 786-394-4188. The Bid title/number shall be referenced on all correspondence. All questions or requests for clarification must be received no later than ten (10)calendar days prior to the date proposals are due as scheduled in Section 0200-3. All responses to questions/clarifications will be sent to all prospective Proposers in the form of an addendum. ITB 2017-039-IC 3 ISA MIAMI BEACH 4. PRE-BID MEETING OR SITE VISIT(S). A Pre-Bid conference will be held as scheduled in Solicitation Timeline above at the following address: City of Miami Beach Procurement Department Conference Room C 1755 Meridian Ave.3rd Floor Miami Beach, Florida 33139 Attendance (in person or via telephone) is encouraged and recommended as a source of information, but is not mandatory. Proposers interested in participating in the Pre-Bid Submission Meeting via telephone must follow these steps: (1) Dial the TELEPHONE NUMBER: 1-888-270-9936(Toll-free North America) (2) Enter the MEETING NUMBER: 9415468 Proposers who are interested in participating via telephone should send an e-mail to the contact person listed in this ITB expressing their intent to participate via telephone. 5. PRE-BID INTERPRETATIONS. Oral information or responses to questions received by prospective Bidders are not binding on the City and will be without legal effect, including any information received at pre-bid meeting or site visit(s). Only questions answered by written addenda will be binding and may supersede terms noted in this solicitation.Addendum will be released through PublicPurchase. 6. CONE OF SILENCE. Pursuant to Section 2-486 of the City Code, all procurement solicitations once advertised and until an award recommendation has been forwarded to the City Commission by the City Manager are under the "Cone of Silence." The Cone of Silence ordinance is available at http://library.municode.Com/index.aspx?clientlD=13097&statelD=9&statename=Florida. Any communication or inquiry in reference to this solicitation with any City employee or City official is strictly prohibited with the of exception communications with the Procurement Director, or his/her administrative staff responsible for administering the procurement process for this solicitation providing said communication is limited to matters of process or procedure regarding the solicitation. Communications regarding this solicitation are to be submitted in writing to the Procurement Contact named herein with a copy to the City Clerk at rafaelgranado@miamibeachfl.gov. 7. SPECIAL NOTICES. You are hereby advised that this solicitation is subject to the following ordinances/resolutions, which may be found on the City Of Miami Beach website: http://web.miamibeachfl.qov/procurement/scroll.aspx?id=23510 • CONE OF SILENCE CITY CODE SECTION 2-486 • PROTEST PROCEDURES CITY CODE SECTION 2-371 • DEBARMENT PROCEEDINGS CITY CODE SECTIONS 2-397 THROUGH 2-485.3 • LOBBYIST REGISTRATION AND DISCLOSURE OF FEES CITY CODE SECTIONS 2-481 THROUGH 2-406 • CAMPAIGN CONTRIBUTIONS BY VENDORS CITY CODE SECTION 2-487 • CAMPAIGN CONTRIBUTIONS BY LOBBYISTS ON PROCUREMENT ISSUES CITY CODE SECTION 2-488 • REQUIREMENT FOR CITY CONTRACTORS TO PROVIDE EQUAL BENEFITS FOR DOMESTIC PARTNERS CITY CODE SECTION 2-373 • LIVING WAGE REQUIREMENT CITY CODE SECTIONS 2-407 THROUGH 2-410 • PREFERENCE FOR FLORIDA SMALL BUSINESSES OWNED AND CONTROLLED BY VETERANS AND TO STATE-CERTIFIED SERVICE- DISABLED VETERAN BUSINESS ENTERPRISES CITY CODE SECTION 2-374 • FALSE CLAIMS ORDINANCE CITY CODE SECTION 70-300 • ACCEPTANCE OF GIFTS,FAVORS&SERVICES CITY CODE SECTION 2-449 ITB 2017-0391C 4 m MIAMI BEACH 8. EXAMINATION OF SOLICITATION DOCUMENTS AND SITE: It is the responsibility of each Bidder, before submitting a Bid,to: • Examine the solicitation thoroughly. • Visit the site or structure, as applicable, to become familiar with conditions that may affect costs, progress, performance or furnishing of the Work. • Take into account federal, state and local (City and Miami-Dade County) laws, regulations, permits, and ordinances that may affect costs, progress, performance,furnishing of the Work,or award. • Study and carefully correlate Bidder's observations with the solicitation. • Notify the Procurement Director of all conflicts, errors or discrepancies in the solicitation of which Bidder knows or reasonably should have known. • The submission of a Bid shall constitute an incontrovertible representation by Bidder that Bidder has complied with the above requirements and that without exception, the Bid is premised upon performing and furnishing the Work required by the solicitation and that the solicitation documents are sufficient in scope and detail to indicate and convey understanding of all terms and conditions for performance and furnishing of the Work. 9. POSTPONEMENT OF DUE DATE FOR RECEIPT OF BIDS.The City reserves the right to postpone the deadline for submittal of bids and will make a reasonable effort to give at least three (3) calendar days written notice of any such postponement to all prospective Bidders through PublicPurchase. 10. PROTESTS. Protests concerning the specifications, requirements, and/or terms; or protests after the bid due date in accordance with City Code Section 2-371, which establishes procedures for protested proposals and proposed awards. Protests not submitted in a timely manner pursuant to the requirements of City Code Section 2-371 shall be barred. 11. VETERAN BUSINESS ENTERPRISES PREFERENCE. Pursuant to City of Miami Beach Ordinance No. 2011- 3748, the City shall give a preference to a responsive and responsible bidder which is a small business concern owned and controlled by a veteran(s) or which is a service-disabled veteran business enterprise, and which is within five percent (5%) of the lowest and best bidder, by providing such bidder an opportunity of providing said goods or contractual services for the lowest responsive bid amount. Whenever, as a result of the foregoing preference, the adjusted prices of two (2)or more bidders which are a small business concern owned and controlled by a veteran(s) or a service-disabled veteran business enterprise constitute the lowest bid pursuant to an ITB or oral or written request for quotation, and such bids are responsive, responsible and otherwise equal with respect to quality and service,then the award shall be made to the service-disabled veteran business enterprise. 12. CONTRACT PRICE. Bid Price is to include the furnishing of all labor, materials, equipment including tools, services, permit fees, applicable taxes, overhead and profit for the completion of the Work except as may be otherwise expressly provided in the solicitation. ITB 2017-039-JC 5 m► MIAMI BEACH 13. METHOD OF AWARD. Following the review of bids and application of vendor preferences, the lowest responsive, responsible bidder(s) meeting all terms, conditions, and specifications of the ITB will be recommended for award by bid item, bid group, or for the entirety of all bid items, as deemed in the best interest of the City, to the City Manager for his consideration. After considering the staff recommendation for award, the City Manager shall exercise his due diligence and recommend to the Mayor and City Commission the bid that the City Manager deems to be in the best interest of the City.The City Commission shall consider the City Manager's recommendation(s)and, may approve or reject the City Manager's recommendation(s). The City Commission may also reject all bids received. In determining the lowest and best bidder, and in addition to price, Section 2-369 of the City Code provides that the City may consider the following: • The ability,capacity and skill of the bidder to perform the Contract. • Whether the bidder can perform the Contract within the time specified,without delay or interference. • The character, integrity, reputation,judgment,experience and efficiency of the bidder. • The quality of performance of previous contracts. • The previous and existing compliance by the bidder with laws and ordinances relating to the Contract. 14. MULTIPLE AWARD.The City may award up to three vendors(primary, secondary, tertiary), as available, by line item, by group or in its entirety. The City will endeavor to utilize vendors in order of award. However, the City may utilize other vendors in the event that: 1) a contract vendor is not or is unable to be in compliance with any contract or delivery requirement; 2) it is in the best interest of the City to do so regardless of reason. 15. BINDING CONTRACT.The signed bid shall be considered an offer on the part of the bidder,which offer shall be deemed accepted upon award of the bid by the City Commission. The City Commission's selection or approval of the City Manager's recommendation shall constitute a binding Contract between the City and the awarded bidder(s). The Contract shall include the solicitation, any and all addenda issued by the City and the Bid Proposal submitted the by bidder. In any discrepancy between the documents, the order of preference shall be as follows: 1)Addendum in reverse order of release;2) Solicitation; 3) Bid Proposal. In case of default on the part of the successful bidder, the City may procure the items or services from other sources and hold the bidder responsible for any excess cost occasioned or incurred thereby. 16. VOLUME OF WORK TO BE RECEIVED BY CONTRACTOR. It is the intent of the City to purchase the goods and services specifically listed in this solicitation from the contractor. However, the City reserves the right to purchase any goods or services awarded from state or other governmental contract, or on an as-needed basis through the City's spot market purchase provisions. 17. GENERAL TERMS AND CONDITIONS. It is the responsibility of the Bidder to become thoroughly familiar with the Bid requirements, terms and conditions of this solicitation. Ignorance by the Bidder of conditions that exist or that may exist will not be accepted as a basis for varying the requirements of the City, or the compensation to be paid to the Bidder. 18. ACCEPTANCE OR REJECTION OF BIDS. The City reserves the right to reject any or all bids prior to award. Reasonable efforts will be made to either award the Contract or reject all bids within one-hundred twenty (120) calendar days after bid opening date. A Bidder may not withdraw its bid unilaterally nor change the Contract Price before the expiration of one hundred and twenty (120) calendar days from the date of bid opening. A Bidder may withdraw its bid after the expiration of one hundred twenty (120) calendar days from the date of bid opening by delivering written notice of withdrawal to the Procurement Department prior to award of the Bid by the Mayor and City Commission. ITB 2017-039-JC 6 m► MIAMI BEACH 19. ALTERNATE RESPONSES MAY BE CONSIDERED. The City may consider one (1) alternate response from the same Bidder for the same formal solicitation; provided, that the alternate response offers a different product that meets or exceeds the formal solicitation requirements. In order for the City to consider an alternate response, the Bidder shall complete a separate Price Sheet form and shall mark "Alternate Response". Alternate response shall be placed in the same response. This provision only applies to formal solicitations for the procurement of goods, services, items, equipment, materials,and/or supplies. 20.AMERICAN WITH DISABILITIES ACT.To request this material in accessible format, sign language interpreters, information on access for persons with disabilities,and/or any accommodation to review any document or participate in any city-sponsored proceeding, please contact 305-604-2489 (voice), 305-673-7524 (fax)or 305-673-7218 (TTY) five days in advance to initiate your request.TTY users may also call 711 (Florida Relay Service). 21. ANTI-DISCRIMINATION. The bidder certifies that he/she is in compliance with the non-discrimination clause contained in Section 202, Executive Order 11246, as amended by Executive Order 11375, relative to equal employment opportunity for all persons without regard to race,color, religion, sex or national origin. 22. ASSIGNMENT. The successful bidder shall not assign, transfer, convey, sublet or otherwise dispose of the contract, including any or all of its right, title or interest therein, or his/her or its power to execute such contract, to any person, company or corporation,without the prior written consent of the City. 23.AUDIT RIGHTS AND RECORDS RETENTION.The Successful Bidder agrees to provide access at all reasonable times to the City, or to any of its duly authorized representatives, to any books, documents, papers and records of Contractor which are directly pertinent to this formal solicitation,for the purpose of audit,examination,excerpts, and transcriptions. The Successful Bidder shall maintain and retain any and all of the books, documents, papers and records pertinent to the Contract for three (3)years after the City makes final payment and all other pending matters are closed. Contractor's failure to or refusal to comply with this condition shall result in the immediate cancellation of this contract by the City. 24. BID BONDS, PERFORMANCE BONDS, CERTIFICATES OF INSURANCE. Bid Bonds,when required, shall be submitted with the bid in the amount specified in the Special Conditions. After acceptance of the bid, the City will notify the successful bidder to submit a performance bond and certificate of insurance in the amount specified in the Special Conditions. 25. BILLING INSTRUCTIONS. Invoices, unless otherwise indicated, must show purchase order numbers and shall be submitted to the ordering City department. 26. CANCELLATION. In the event any of the provisions of this Bid are violated by the bidder, the City shall give written notice to the bidder stating such deficiencies and, unless such deficiencies are corrected within ten (10) calendar days from the date of the City's notice, the City, through its City Manager, may declare the contract in default and terminate same, without further notice required to the bidder. Notwithstanding the preceding, the City, through its City Manager, also reserves the right to terminate the contract at any time and for any reason, without cause and for convenience, and without any monetary liability to the City, upon the giving of thirty (30) days prior written notice to the bidder. 27. CITY'S RIGHT TO WAIVE OR REJECT BIDS. The City Commission reserves the right to waive any informalities or irregularities in this Bid; or to reject all bids, or any part of any bid, as it deems necessary and in the best interest of the City of Miami Beach. 28. CLARIFICATION AND ADDENDA TO BID SPECIFICATIONS. If a bidder is in doubt as to the true meaning of ITB 2017-0391C 7 m MIAMI BEACH the Bid specifications, or other Bid documents, or any part thereof, the bidder must submit to the City, at least ten (10) calendar days prior to the scheduled Bid opening date,a request for clarification. Any interpretation of the Bid, including,without limitation, responses to questions and request for clarification(s)from bidders, will be made only by Addendum duly issued by the City. In the event of conflict with the original specifications, the Addendum shall supersede such specifications, to the extent specified. Subsequent Addendum shall govern over prior Addendum only to the extent specified. The bidder shall be required to acknowledge receipt of any and all Addendum, and filling in and signing in the spaces provided in section 5.0, Acknowledgements/Affidavits. Failure to acknowledge Addendum may deem a bid non-responsive. The City will not be responsible for explanations, interpretations, or answers to questions made verbally or in writing by any City representative, unless issued by the City via formal written Addendum to this Bid. Any questions or clarifications concerning the Bid shall be submitted in writing to the Procurement Department (DPM), 1755 Meridian Ave.3rd Floor, Miami Beach, FL 33139 with a copy to the City Clerk. 29. COLLUSION.Where two (2)or more related parties each submit a bid or bids for any contract, such bids or bids shall be presumed to be collusive. The foregoing presumption may be rebutted by presentation of evidence as to the extent of ownership, control and management of such related parties in the preparation and submittal of such bid or bids. "Related parties"means bidders or the principals thereof which have a direct or indirect ownership interest in another bidder for the same contract,or in which a parent company or the principals thereof of one (1) bidder have a direct or indirect ownership interest in another bidder for the same contract. Bid or bids found to be collusive shall be rejected. Bidders who have been found to have engaged in collusion may also be suspended or debarred, and any contract resulting from collusive bidding may be terminated for cause. 30. CONDITION AND PACKAGING. Bidder guarantees items offered and delivered to be the current standard production model at time of bid and shall offer expiration dating of at least one year or later. Bidder also guarantees items offered and delivered to be new, unused, and free from any and all defects in material, packaging and workmanship and agrees to replace defective items promptly at no charge to the City of Miami Beach, for the manufacturer's standard warranty but in no case for a period of less than 12 months from date of acceptance. All containers shall be suitable for storage or shipment, and all prices shall include standard commercial packaging. 31. CONTRACT EXTENSION. The City reserves the right to require the Contractor to extend contract past the stated termination date for a period of up to 120 days in the event that a subsequent contract has not yet been awarded.Additional extensions past the 120 days may occur as needed by the City and as mutually agreed upon by the City and the contractor. 32. DELIVERY. Unless actual date of delivery is specified (or if specified delivery cannot be met), show number of days (in calendar days) required to make delivery after receipt of purchase order, in space provided. Delivery time may become a basis for making an award. Delivery shall be within the normal working hours of the City using Department, Monday through Friday, excluding holidays. Receiving hours are Monday through Friday, excluding holidays,from 8:30 A.M.to 4:00 P.M. 33. DELIVERY TIME. Bidders shall specify in the attached Bid Form,the guaranteed delivery time (in calendar days) for each item. It must be a firm delivery time; no ranges(For example, 12-14 days)will be accepted. ITB 2017-039-JC 8 m► MIAMI BEACH 34. DEMONSTRATION OF COMPETENCY. A. Pre-award inspection of the bidder's facility may be made prior to the award of contract. B. Bids will only be considered from firms which are regularly engaged in the business of providing the goods and/or services as described in this Bid. C. Bidders must be able to demonstrate a good record of performance for a reasonable period of time, and have sufficient financial capacity, equipment, and organization to ensure that they can satisfactorily perform the services if awarded a contract under the terms and conditions of this Bid. D. the terms "equipment and organization", as used herein shall, be construed to mean a fully equipped and well established company in line with the best business practices in the industry, and as determined by the City of Miami Beach. E. The City may consider any evidence available regarding the financial, technical, and other qualifications and abilities of a bidder, including past performance (experience), in making an award that is in the best interest of the City. F. The City may require bidders to show proof that they have been designated as authorized representatives of a manufacturer or supplier, which is the actual source of supply. In these instances, the City may also require material information from the source of supply regarding the quality, packaging, and characteristics of the products to be supply to the City. Any material conflicts between information provided by the source of supply and the information contained in the bidder's bid may render the bid non-responsive. G. The City may, during the period that the contract between the City and the successful bidder is in force, review the successful bidder's record of performance to ensure that the bidder is continuing to provide sufficient financial support, equipment, and organization as prescribed in this bid. Irrespective of the bidder's performance on contracts awarded to it by the City, the City may place said contracts on probationary status and implement termination procedures if the City determines that the successful bidder no longer possesses the financial support, equipment, and organization which would have been necessary during the bid evaluation period in order to comply with the demonstration of competency required under this subsection. 35. DISPUTES. In case of any doubt or difference of opinion as to the items and/or services(as the case may be)to be furnished hereunder,the decision of the City shall be final and binding on all parties. 36. DISPUTES. In the event of a conflict between the Bid documents, the order of priority of the documents shall be as follows: A. Any contract or agreement resulting from the award of this Bid;then B. Addendum issued for this Bid,with the latest Addendum taking precedence; then C. The Bid; then D. The bidder's bid in response to the Bid. 37. DEFAULT. Failure or refusal of a bidder to execute a contract upon award, or withdrawal of a bid before such award is made, may result in forfeiture of that portion of any bid surety required as liquidated damages incurred by the City thereby; or, where surety is not required, failure to execute a contract as described above may be grounds for removing the bidder from the City's bidders list. 38. EQUIVALENTS. If a bidder offers makes of equipment or brands of supplies other than those specified in the Bid specifications, he must so indicate in his bid. Specific article(s) of equipment/supplies shall conform in quality, design and construction with all published claims of the manufacturer. ITB 2017-039-IC 9 OA_ MIAMI BEACH The bidder shall indicate in the Bid Form the manufacturer's name and number if bidding other than the specified brands, and shall indicate ANY deviation from the specifications as listed in the Bid. Other than specified items offered requires complete descriptive technical literature marked to indicate detailed conformance with specifications, and MUST BE INCLUDED WITH THE BID. NO BIDS WILL BE CONSIDERED WITHOUT THIS INFORMATION. THE CITY SHALL BE THE SOLE JUDGE OF EQUALITY AND ITS DECISION SHALL BE FINAL. Note as to Brand Names: Catalog numbers, manufacturers' and brand names,when listed, are informational guides as to a standard of acceptable product quality level only and should not be construed as an endorsement or a product limitation of recognized and legitimate manufacturers. Bidders shall formally substantiate and verify that product(s)offered conform with or exceed quality as listed in the specifications. 39. ELIMINATION FROM CONSIDERATION. This bid shall not be awarded to any person or firm who is in arrears to the City upon any debt, taxes, or contracts which are defaulted as surety or otherwise upon any obligation to the City. 40. EMERGENCY RESPONSE PRIORITY. It is hereby made a part of this solicitation that before,during, and after a public emergency, disaster, hurricane, tornado, flood, or other acts of force majeure that the City of Miami Beach, Florida shall receive a "First Priority" for any goods and services covered under any award resulting from this solicitation, including balance of line items as applicable. It is vital and imperative that the majority of citizens are protected from any emergency situation that threatens public health and safety, as determined by the City. By virtue of submitting a response to this solicitation, vendor agrees to provide all award-related goods and services to the City on a"first priority"under the emergency conditions noted above. 41. ESTIMATED QUANTITIES. Estimated quantities or estimated dollars, if provided, are for City guidance only. No guarantee is expressed or implied as to quantities or dollars that will be used during the contract period. The City is not obligated to place any order for a given amount subsequent to the award of this Bid. Estimates are based upon the City's actual needs and/or usage during a previous contract period. The City may use said estimates for purposes of determining whether the low bidder meets specifications. 42. EXCEPTIONS TO BID. Bidders are strongly encouraged to thoroughly review the specifications and all conditions set forth in this Bid. Bidders who fail to satisfy the requirements in this Bid, may be deemed non- responsive and receive no further consideration. Should your proposed bid not be able to meet one (1) or more of the requirements set forth in this Bid and you are proposing alternatives and/or exceptions to said requirements,you must notify the Procurement Office, in writing, at least five (5) days prior to the deadline for submission of bids. The City reserves the right to revise the scope of services via Addendum prior to the deadline for receipt of bids. 43. FACILITIES. The City, through its City Manager or his/her authorized designee, reserves the right to inspect the bidder's facilities at any time, upon reasonable prior written or verbal notice. ITB 2017-0391C 10 m MIAMI BEACH 44. FLORIDA PUBLIC RECORDS LAW. Bidders are hereby notified that all Bid including, without limitation, any and all information and documentation submitted therewith, are exempt from public records requirements under Section 119.07(1), Florida Statutes, and s. 24(a), Art. 1 of the State Constitution until such time as the City provides notice of an intended decision or until thirty (30) days after opening of the bids, whichever is earlier. Additionally, Contractor agrees to be in full compliance with Florida Statute 119.0701 including, but not limited to, agreement to (a) Keep and maintain public records that ordinarily and necessarily would be required by the public agency in order to perform the services; (b) provide the public with access to public records on the same terms and conditions that the public agency would provide the records and at a cost that does not exceed the cost provided in this chapter or as otherwise provided by law; (c) Ensure that public records that are exempt or confidential and exempt from public records disclosure requirements are not disclosed except as authorized by law; (d) Meet all requirements for retaining public records and transfer, at no cost, to the public agency all public records in possession of the contractor upon termination of the contract and destroy any duplicate public records that are exempt or confidential and exempt from public records disclosure requirements. All records stored electronically must be provided to the public agency in a format that is compatible with the information technology systems of the public agency. 45. F.O.B. DESTINATION. Unless otherwise specified in the Formal Solicitation, all prices quoted/proposed by the bidder must be F.O.B. DESTINATION, inside delivery, with all delivery costs and charges included in the bid price, unless otherwise specified in this Formal Solicitation. Failure to do so may be cause for rejection of bid. 46. GRATUITIES. Bidders shall not offer any gratuities, favors, or anything of monetary value to any official, employee, contractor,or agent of the City,for the purpose of influencing consideration of this Bid. 47. INDEMNIFICATION. The successful Bidder shall indemnify and hold harmless the City and its officers, employees, agents and instrumentalities from any and all liability, losses or damages, including attorney's fees and costs of defense, which the City or its officers, employees, agents or instrumentalities may incur as a result of claims, demands, suits, causes of actions or proceedings of any kind or nature arising out of, relating to or resulting from the performance of the agreement by the successful Bidder or its employees, agents, servants, partners, principals or subcontractors. The successful Bidder shall pay all claims and losses in connection therewith, and shall investigate and defend all claims, suits or actions of any kind or nature in the name of the City, where applicable, including appellate proceedings, and shall pay all costs, judgments, and attorney's fees which may be incurred thereon. The successful Bidder expressly understands and agrees that any insurance protection required by this Agreement or otherwise provided by the successful Bidder shall in no way limit the responsibility to indemnify, keep and save harmless and defend the City or its officers, employees, agents and instrumentalities as herein provided. The above indemnification provisions shall survive the expiration or termination of this Agreement. 48. INSPECTION, ACCEPTANCE & TITLE. Inspection and acceptance will be at destination, unless otherwise provided. Title to (or risk of loss or damage to) all items shall be the responsibility of the successful bidder until acceptance by the City, unless loss or damage results from the gross negligence or willful misconduct of the City. If any equipment or supplies supplied to the City are found to be defective, or do not conform to the specifications, the City reserves the right to cancel the order upon written notice to the seller, and return the product, at the bidders expense. 49. LAWS, PERMITS AND REGULATIONS.The bidder shall obtain and pay for all licenses, permits, and inspection fees required under the contract; and shall comply with all Applicable Laws. ITB 2017-039-JC 11 m► MIAMI BEACH 50. LEGAL REQUIREMENTS. The bidder shall be required to comply with all federal, State of Florida, Miami-Dade County, and City of Miami Beach codes, laws, ordinances, and/or rules and regulations that in any manner affect the items covered herein (collectively, Applicable Laws). Lack of knowledge or ignorance by the bidder with/of Applicable Laws will in no way be a cause for relief from responsibility. 51. LIABILITY, INSURANCE, LICENSES AND PERMITS. Where bidders are required to enter or go on to City of Miami Beach property to deliver materials or perform work or services as a result of the Bid, the bidder will assume the full duty, obligation and expense of obtaining all necessary licenses, permits, and insurance, and assure all work complies with all Applicable Laws. The bidder shall be liable for any damages or loss to the City occasioned by negligence of the bidder, or his/her officers, employees, contractors, and/or agents, for failure to comply with Applicable Laws. 52. MANNER OF PERFORMANCE. Bidder agrees to perform its duties and obligations in a professional manner and in accordance with all applicable Local, State, County, and Federal laws, rules, regulations and codes. Bidder agrees that the services provided shall be provided by employees that are educated, trained, experienced, certified, and licensed in all areas encompassed within their designated duties. Bidder agrees to furnish to the City any and all documentation, certification, authorization, license, permit, or registration currently required by applicable laws, rules, and regulations. Bidder further certifies that it and its employees will keep all licenses, permits, registrations, authorizations, or certifications required by applicable laws or regulations in full force and effect during the term of this contract. Failure of bidder to comply with this paragraph shall constitute a material breach of this contract. 53. MISTAKES. Bidders are expected to examine the specifications, delivery schedules, bid prices, and extensions, and all instructions pertaining to supplies and services. Failure to do so will be at the bidders risk and may result in the bid being non-responsive. 54. MODIFICATION/WITHDRAWALS OF BIDS. A bidder may submit a modified bid to replace all or any portion of a previously submitted bid up until the bid due date and time. Modifications received after the bid due date and time will NOT be considered. Bids shall be irrevocable until contract award unless withdrawn in writing prior to the bid due date or after expiration of 120 calendar days from the opening of bids without a contract award. Letters of withdrawal received after the bid due date and before said expiration date and letters of withdrawal received after contract award will NOT be considered. 55. NON-CONFORMANCE TO CONTRACT CONDITIONS. Items may be tested for compliance with specifications. Items delivered, not conforming to specifications, may be rejected and returned at the bidders expense. These items, as well as items not delivered as per delivery date in bid and/or purchase order, may be purchased by the City, at its discretion, on the open market. Any increase in cost may be charged against the bidder. Any violation of these stipulations may also result in the bidder's name being removed from the City's vendor list. 56. OPTIONAL CONTRACT USAGE. When the successful bidder(s) is in agreement, other units of government or non-profit agencies may participate in purchases pursuant to the award of this contract at the option of the unit of government or non-profit agency. 57. OSHA. The bidder warrants to the City that any work, services, supplies, materials or equipment supplied pursuant to this Bid shall conform in all respects to the standards set forth in the Occupational Safety and Health Act of 1970, as amended, and the failure to comply with this condition will be deemed breach of contract. Any fines levied because of inadequacies to comply with this condition shall be borne solely by the bidder. ITB 2017-039-IC 12 O.__ BEACH 58. PATENTS & ROYALTIES. The bidder shall indemnify and save harmless the City of Miami Beach, Florida, and its officers, employees, contractors, and/or agents, from liability of any nature or kind, including cost and expenses for, or on account of, any copyrighted, patented,or unpatented invention, process, or article manufactured or used in the performance of the contract, including its use by the City of Miami Beach, Florida. If the bidder uses any design, device or materials covered by letters, patent, or copyright, it is mutually understood and agreed,without exception, that the bid prices shall include all royalties or cost arising from the use of such design, device, or materials in any way involved in the work. 59. PAYMENT. Payment will be made by the City after the items have been received, inspected, and found to comply with Bid specifications,free of damage or defect, and properly invoiced. 60. PRICES QUOTED. Prices quoted shall remain firm and fixed during the duration of the contract. In completing the bid form, state both unit price and extended total, when requested. Prices must be stated in units of quantity specified in the bidding specifications. In case of discrepancy in computing the amount of the bid, the UNIT PRICE quoted will govern. All prices must be F.O.B. destination, freight prepaid (unless otherwise stated in Special Conditions). The Bidder may offer cash discounts for prompt payments; however, such discounts will not be considered in determining the lowest price during bid evaluation. Bidders are requested to provide prompt payment terms in the space provided on the Bid submittal signature page of the solicitation. Award, if made, will be in accordance with terms and conditions stated herein. Each item must be bid separately, and no attempt is to be made to tie any item or items in with any other item or items. Cash or quantity discounts offered will not be a consideration in determination of award of bid(s). 61. PRODUCT INFORMATION. Product literature, specifications, and technical information, including Manufacturer's Safety Data Sheets (MSDS) should be provided with this bid as an attachment to the "BID FORM". However, in all cases must be provided within five(5)calendar days upon request from Purchasing Agent. 62. REASONABLE ACCOMMODATION. In accordance with Title II of the Americans with Disabilities Act, any person requiring an accommodation at the Bid opening because of a disability must contact the Procurement Division. 63. SAMPLES. Bids submitted as an "equal" product must be accompanied with detailed specifications. Samples of items, when required, must be furnished free of expense and, if not destroyed,will, upon request, be returned at the bidder's expense. Bidders will be responsible for the removal of all samples furnished within (30) days after bid opening. All samples will be disposed of after thirty (30) days. Each individual sample must be labeled with the bidder's name. Failure of the bidder to either deliver required samples, or to clearly identify samples may be reason for rejection of the bid. Unless otherwise indicated, samples should be delivered to the Procurement Division, 1755 Meridian Ave. 3rd Floor, Miami Beach, FL 33139. 64. SPECIAL CONDITIONS. Any and all Special Conditions that may vary from these General Terms and Conditions shall have precedence. 65. SPOT MARKET PURCHASES. It is the intent of the City to purchase the items specifically listed in this Bid from the successful bidder. However, the City reserves the right to purchase the items from state or other governmental contract, or on an as-needed basis through the City's spot market purchase provisions. ITB 2017-039-JC 13 .0_ BEACH 66. SUBSTITUTIONS. After award of contract, the City WILL NOT accept substitute shipments of any kind, without previous written approval. The bidder is expected to furnish the brand quoted in its bid. Any substitute shipments will be returned at the bidder's expense. 67.TAXES.The City of Miami Beach is exempt from all Federal Excise and State taxes. 68. TIE BIDS. In accordance with Florida Statues Section 287.087, regarding identical tie bids, preference will be given to bidders certifying that they have implemented a drug free work place program. A certification form will be required. In the event of a continued tie between two or more bidders after consideration of the drug free workplace program, the City's Local Preference and Veteran Preference ordinances will dictate the manner by which a tie is to be resolved. In the event of a continued tie after the Local and Veteran Preference ordinances have been applied or the tie exists between bidders that are not Local or Veteran, the breaking of the tie shall be at the City Manager's discretion,which will make a recommendation for award to the City Commission. 69. TERMINATION FOR DEFAULT. If the successful bidder shall fail to fulfill in a timely manner, or otherwise violate, any of the covenants, agreements, or stipulations material to the Bid and/or the contract entered into with the City pursuant thereto, the City shall thereupon have the right to terminate the work and/or services then remaining to be performed by giving written notice to the bidder of such termination,which shall become effective upon receipt by the bidder of the written termination notice. In that event, the City shall compensate the successful bidder in accordance with the term of the contract for all work and/or services satisfactorily performed by the bidder prior to termination, net of any costs incurred by the City as a consequence of the default. Notwithstanding the above, the successful bidder shall not be relieved of liability to the City for damages sustained by the City by virtue of any breach of the contract by the bidder, and the City may reasonably withhold payments to the successful bidder for the purposes of set off until such time as the exact amount of damages due the City from the successful bidder is determined. The City may, at its discretion, provide reasonable"cure period"for any contractual violation prior to termination of the contract; should the successful bidder fail to take the corrective action specified in the City's notice of default within the allotted cure period, then the City may proceed to terminate the contract for cause in accordance with this subsection 1.57. 70. TERMINATION FOR CONVENIENCE OF CITY. The City may, for its convenience, terminate the work and/or services then remaining to be performed, at any time, by giving written notice to the successful bidder of such termination,which shall become effective thirty(30)days following receipt by bidder of such notice. In that event, all finished or unfinished documents and other materials shall be properly delivered to the City. If the contract is terminated by the City as provided in this subsection,the City shall compensate the successful bidder in accordance with the terms of the contract for all and without cause and/or any resulting liability to the City, work and/or services actually performed by the successful bidder, and shall also compensate the bidder for its reasonable direct costs in assembling and delivering to City all documents. No compensation shall be due to the successful bidder for any profits that the successful bidder expected to earn on the balanced of the contract. Such payments shall be the total extent of the City's liability to the successful bidder upon a termination as provided for in this subsection. 71. UNDERWRITERS' LABORATORIES. Unless otherwise stipulated in the Bid, all manufactured items and fabricated assemblies shall be U.L. listed or re-examination listing where such has been established by U.L. for the item(s)offered and furnished. ITB 2017-039-JC 14 m MIAMI BEACH 72. ADDITIONAL SERVICES. Although this solicitation and resultant contract identifies specific goods, services or facilities ("items"), it is hereby agreed and understood that the City, through the approval of the Department and Procurement Directors (for additional items up to $50,000) or the City Manager (for additional items greater than $50,000), may require additional items to be added to the Contract which are required to complete the work. When additional items are required to be added to the Contract, awarded vendor(s), as applicable to the item being requested, under this contract may be invited to submit price quote(s) for these additional requirements. If these quote(s) are determined to be fair and reasonable, then the additional work will be awarded to the current contract vendor(s) that offers the lowest acceptable pricing. The additional items shall be added to this contract by through a Purchase Order(or Change Order if Purchase Order already exists). In some cases,the City may deem it necessary to add additional items through a formal amendment to the Contract,to be approved by the City Manager. The City may determine to obtain price quotes for the additional items from other vendors in the event that fair and reasonable pricing is not obtained from the current contract vendors, or for other reasons at the City's discretion. The remainder of this page is intentionally left blank. ITB 2017-039-JC 15 m \ AMI BEACH SECTION 0300 PROPOSAL SUBMITTAL INSTRUCTIONS AND FORMAT 1. SEALED BIDS. One original Bid Proposal (preferably in 3-ring binder) must be submitted in an opaque, sealed envelope or container on or before the due date established for the receipt of bids. Additionally, three (3) bound copies and one (1) electronic format(CD or USB format) are to be submitted, with the original submission or within two (2) days of request by the City. The following information should be clearly marked on the face of the envelope or container in which the bid is submitted: Bid Number, Bid Title, Bidders Name, Bidder Return Address. Bids received electronically, either through email or facsimile,are not acceptable and will be rejected. 2. BID PROPOSAL.The Bid Proposal is to include the following: • TAB 1 — Cost Proposal Form (Appendix E). The Cost Proposal Form (Appendix E) shall be completed mechanically or, if manually, in ink. Cost Proposal Forms submitted in pencil shall be deemed non- responsive.All corrections on the Cost Proposal Form shall be initialed. • TAB 2-Bid Certification,Questionnaire and Affidavits(Appendix A). • TAB 3—Documentation indicating compliance with Minimum Eligibility Requirements. 3. LATE BIDS. Bid Proposals are to be received on or before the due date established herein for the receipt of Bids. Any Bid received after the deadline established for receipt of proposals will be considered late and not be accepted or will be returned to Proposer unopened. The City does not accept responsibility for any delays, natural or otherwise. ITB 2017-0391C 16 APPENDIX A ItS-A MIAMI BEACH Proposal Certification , Questionnaire & Requirements Affidavit ITB 2017-039-JC Plumbing Services PROCUREMENT DEPARTMENT 1755 Meridian Ave. 3rd Floor Miami Beach, Florida 33139 ITB 2017-039-1C 17 Solicitation No: Solicitation Title: 2017-039-JC Plumbing Services Procurement Contact Tel: Email: Jason Crouch 305-673-7000 x7490 jasoncrouch@miamibeachfl.gov PROPOSAL CERTIFICATION, QUESTIONNAIRE&REQUIREMENTS AFFIDAVIT Purpose: The purpose of this Proposal Certification, Questionnaire and Requirements Affidavit Form is to inform prospective Proposers of certain solicitation and contractual requirements, and to collect necessary information from Proposers in order that certain portions of responsiveness, responsibility and other determining factors and compliance with requirements may be evaluated. This Proposal Certification, Questionnaire and Requirements Affidavit Form is a REQUIRED FORM that must be submitted fully completed and executed. 1. General Proposer Information. FIRM NAME: No of Years in Business: No of Years in Business Locally: No.of Employees: OTHER NAME(S)PROPOSER HAS OPERATED UNDER IN THE LAST 10 YEARS: FIRM PRIMARY ADDRESS(HEADQUARTERS): CITY: STATE: ZIP CODE: TELEPHONE NO.: TOLL FREE NO.: FAX NO.: FIRM LOCAL ADDRESS: CITY: STATE: ZIP CODE: PRIMARY ACCOUNT REPRESENTATIVE FOR THIS ENGAGEMENT: ACCOUNT REP TELEPHONE NO.: ACCOUNT REP TOLL FREE NO.: ACCOUNT REP EMAIL: FEDERAL TAX IDENTIFICATION NO.: The City reserves the right to seek additional information from Proposer or other source(s),including but not limited to:any firm or principal information,applicable licensure,resumes of relevant individuals,client information,financial information,or any information the City deems necessary to evaluate the capacity of the Proposer to perform in accordance with contract requirements. ITB 2017-039-JC 18 1. Veteran Owned Business.Is Proposer claiming a veteran owned business status? YES NO SUBMITTAL REQUIREMENT: Proposers claiming veteran owned business status shall submit a documentation proving that firm is certified as a veteran-owned business or a service-disabled veteran owned business by the State of Florida or United States federal government,as required pursuant to ordinance 2011-3748. 2. Financial Capacity.Each Proposer shall arrange for Dun&Bradstreet to submit a Supplier Qualification Report(SQR)directly to the Procurement Contact named herein. No proposal will be considered without receipt,by the City,of the SQR directly from Dun &Bradstreet. The cost of the preparation of the SQR shall be the responsibility of the Proposer.The Proposer shall request the SQR report from D&B at: httos:llsupplierportal.dnb.comlwebapo/wcslstoreslservletlSupplierPortal?storeld=11696 Proposers are responsible for the accuracy of the information contained in its SQR.It is highly recommended that each Proposer review the information contained in its SQR for accuracy prior to submittal to the City and as early as possible in the solicitation process. For assistance with any portion of the SQR submittal process, contact Dun & Bradstreet at 800-424-2495. SUBMITTAL REQUIREMENT: Proposer shall request that Dun & Bradstreet submit its Supplier Qualifier Report directly to the City,with bid or within 2 days of request. 3. Conflict Of Interest.All Proposers must disclose,in their Proposal,the name(s)of any officer,director,agent,or immediate family member (spouse, parent, sibling, and child) who is also an employee of the City of Miami Beach. Further, all Proposers must disclose the name of any City employee who owns, either directly or indirectly, an interest of ten (10%) percent or more in the Proposer entity or any of its affiliates. SUBMITTAL REQUIREMENT: Proposers must disclose the name(s)of any officer, director, agent, or immediate family member (spouse,parent,sibling,and child)who is also an employee of the City of Miami Beach. Proposers must also disclose the name of any City employee who owns,either directly or indirectly,an interest of ten(10%)percent or more in the Proposer entity or any of its affiliates. 4. References&Past Performance.Proposer shall submit at least three(3)references for whom the Proposer has completed work similar in size and nature as the work referenced in solicitation. SUBMITTAL REQUIREMENT: For each reference submitted, the following information is required: 1) Firm Name, 2) Contact Individual Name&Title,3)Address,4)Telephone,5)Contact's Email and 6)Narrative on Scope of Services Provided. 5. Suspension,Debarment or Contract Cancellation.Has Proposer ever been debarred,suspended or other legal violation,or had a contract cancelled due to non- erformance by an ublic sector agency? YES NO SUBMITTAL REQUIREMENT: If answer to above is"YES," Proposer shall submit a statement detailing the reasons that led to action(s). 6. Vendor Campaign Contributions. Proposers are expected to be or become familiar with,the City's Campaign Finance Reform laws, as codified in Sections 2-487 through 2-490 of the City Code. Proposers shall be solely responsible for ensuring that all applicable provisions of the City's Campaign Finance Reform laws are complied with,and shall be subject to any and all sanctions, as prescribed therein,including disqualification of their Proposals,in the event of such non-compliance. SUBMITTAL REQUIREMENT: Submit the names of all individuals or entities (including your sub-consultants)with a controlling financial interest as defined in solicitation. For each individual or entity with a controlling financial interest indicate whether or not each individual or entity has contributed to the campaign either directly or indirectly, of a candidate who has been elected to the office of Mayor or City Commissioner for the City of Miami Beach. 7. Code of Business Ethics.Pursuant to City Resolution No.2000-23879,each person or entity that seeks to do business with the City shall adopt a Code of Business Ethics("Code")and submit that Code to the Procurement Division with its proposal/response or within five(5)days upon receipt of request.The Code shall, at a minimum, require the Proposer,to comply with all applicable governmental rules and regulations including, among others, the conflict of interest, lobbying and ethics provision of the City of ITB 2017-039-JC 19 Miami Beach and Miami Dade County. SUBMITTAL REQUIREMENT: Proposer shall submit firm's Code of Business Ethics. In lieu of submitting Code of Business Ethics,Proposer may submit a statement indicating that it will adopt,as required in the ordinance,the City of Miami Beach Code of Ethics,available at www.miamibeachfl.gov/procurement/. 8. Living Wage.Pursuant to Section 2-408 of the Miami Beach City Code,as same may be amended from time to time, Proposers shall be required to pay all employees who provide services pursuant to this Agreement,the hourly living wage rates listed below: • Commencing with City fiscal year 2012-13(October 1,2012),the hourly living rate will be$11.62/hr with health benefits of at least$1.69,and$13.31/hr without benefits. The living wage rate and health care benefits rate may, by Resolution of the City Commission be indexed annually for inflation using the Consumer Price Index for all Urban Consumers(CPI-U)Miami/Ft.Lauderdale,issued by the U.S.Department of Labor's Bureau of Labor Statistics. Notwithstanding the preceding,no annual index shall exceed three percent(3%).The City may also,by resolution,elect not to index the living wage rate in any particular year,if it determines it would not be fiscally sound to implement same(in a particular year). Proposers'failure to comply with this provision shall be deemed a material breach under this proposal,under which the City may, at its sole option, immediately deem said Proposer as non-responsive, and may further subject Proposer to additional penalties and fines,as provided in the City's Living Wage Ordinance,as amended. Further information on the Living Wage requirement is available at www.miamibeachfl.gov/procurement/. SUBMITTAL REQUIREMENT: No additional submittal is required. By virtue of executing this affidavit document, Proposer agrees to the living wage requirement. 9. Equal Benefits for Employees with Spouses and Employees with Domestic Partners. When awarding competitively solicited contracts valued at over$100,000 whose contractors maintain 51 or more full time employees on their payrolls during 20 or more calendar work weeks,the Equal Benefits for Domestic Partners Ordinance 2005-3494 requires certain contractors doing business with the City of Miami Beach,who are awarded a contract pursuant to competitive proposals,to provide"Equal Benefits"to their employees with domestic partners, as they provide to employees with spouses. The Ordinance applies to all employees of a Contractor who work within the City limits of the City of Miami Beach,Florida;and the Contractor's employees located in the United States, but outside of the City of Miami Beach limits, who are directly performing work on the contract within the City of Miami Beach. A. Does your company provide or offer access to any benefits to employees with spouses or to spouses of employees? YES NO B. Does your company provide or offer access to any benefits to employees with(same or opposite sex)domestic partners*or to domestic partners of employees? YES [ NO C. Please check all benefits that apply to your answers above and list in the "other" section any additional benefits not already specified. Note:some benefits are provided to employees because they have a spouse or domestic partner,such as bereavement leave;other benefits are provided directly to the spouse or domestic partner,such as medical insurance. BENEFIT Firm Provides for Firm Provides for Firm does not Employees with Employees with Provide Benefit Spouses Domestic Partners Health Sick Leave Family Medical Leave Bereavement Leave If Proposer cannot offer a benefit to domestic partners because of reasons outside your control, (e.g., there are no insurance providers in your area willing to offer domestic partner coverage)you may be eligible for Reasonable Measures compliance. To comply on this basis, you must agree to pay a cash equivalent and submit a completed Reasonable Measures Application (attached)with all necessary documentation.Your Reasonable Measures Application will be reviewed for consideration by the City Manager, or his designee.Approval is not guaranteed and the City Manager's decision is final. Further information on the Equal Benefits requirement is available at www.miamibeachfl.gov/procurement/. ITB 2017-039-JC 20 10. Public Entity Crimes.Section 287.133(2)(a),Florida Statutes,as currently enacted or as amended from time to time,states that a person or affiliate who has been placed on the convicted vendor list following a conviction for a public entity crime may not submit a proposal,bid,or reply on a contract to provide any goods or services to a public entity;may not submit a proposal, bid,or reply on a contract with a public entity for the construction or repair of a public building or public work;may not submit proposals,bids,or replies on leases of real property to a public entity;may not be awarded or perform work as a contractor,supplier,subcontractor,or consultant under a contract with any public entity;and may not transact business with any public entity in excess of the threshold amount provided in s.287.017 for CATEGORY TWO for a period of 36 months following the date of being placed on the convicted vendor list. SUBMITTAL REQUIREMENT: No additional submittal is required.By virtue of executing this affidavit document, Proposer agrees with the requirements of Section 287.133,Florida Statutes,and certifies it has not been placed on convicted vendor list. 11. Non-Discrimination.Pursuant to City Ordinance No.2016-3990,the City shall not enter into a contract with a business unless the business represents that it does not and will not engage in a boycott as defined in Section 2-375(a)of the City Code,including the blacklisting,divesting from,or otherwise refusing to deal with a person or entity when such action is based on race,color,national origin,religion,sex,intersexuality,gender identity,sexual orientation,marital or familial status,age or disability. SUBMITTAL REQUIREMENT: No additional submittal is required.By virtue of executing this affidavit document,Proposer agrees it is and shall remain in full compliance with Section 2-375 of the City of Miami Beach City Code. 12. Moratorium on Travel to and the Purchase of Goods or Services from North Carolina and Mississippi. Pursuant to Resolution 2016-29375, the City of Miami Beach, Florida, prohibits official City travel to the states of North Carolina and Mississippi,as well as the purchase of goods or services sourced in North Carolina and Mississippi. Proposer shall agree that no travel shall occur on behalf of the City to North Carolina or Mississippi,nor shall any product or services it provides to the City be sourced from these states. SUBMITTAL REQUIREMENT: No additional submittal is required.By virtue of executing this affidavit document, Proposer agrees it is and shall remain in full compliance with Resolution 2016-29375. 13. Acknowledgement of Addendum. After issuance of solicitation,the City may release one or more addendum to the solicitation which may provide additional information to Proposers or alter solicitation requirements. The City will strive to reach every Proposer having received solicitation through the City's e-procurement system, PublicPurchase.com. However, Proposers are solely responsible for assuring they have received any and all addendum issued pursuant to solicitation.This Acknowledgement of Addendum section certifies that the Proposer has received all addendum released by the City pursuant to this solicitation. Failure to obtain and acknowledge receipt of all addendum may result in proposal disqualification. Initial to Confirm Initial to Confirm Initial to Confirm Receipt Receipt Receipt Addendum 1 Addendum 6 Addendum 11 Addendum 2 Addendum 7 Addendum 12 Addendum 3 Addendum 8 Addendum 13 Addendum 4 Addendum 9 Addendum 14 Addendum 5 Addendum 10 Addendum 15 If additional confirmation of addendum is required,submit under separate cover. ITB 2017-039-JC 21 DISCLOSURE AND DISCLAIMER SECTION The solicitation referenced herein is being furnished to the recipient by the City of Miami Beach (the"City")for the recipient's convenience. Any action taken by the City in response to Proposals made pursuant to this solicitation,or in making any award,or in failing or refusing to make any award pursuant to such Proposals,or in cancelling awards,or in withdrawing or cancelling this solicitation,either before or after issuance of an award,shall be without any liability or obligation on the part of the City. In its sole discretion,the City may withdraw the solicitation either before or after receiving proposals, may accept or reject proposals, and may accept proposals which deviate from the solicitation,as it deems appropriate and in its best interest. In its sole discretion,the City may determine the qualifications and acceptability of any party or parties submitting Proposals in response to this solicitation. Following submission of a Bid or Proposal, the applicant agrees to deliver such further details, information and assurances, including financial and disclosure data, relating to the Proposal and the applicant including, without limitation, the applicant's affiliates, officers, directors,shareholders,partners and employees,as requested by the City in its discretion. The information contained herein is provided solely for the convenience of prospective Proposers. It is the responsibility of the recipient to assure itself that information contained herein is accurate and complete.The City does not provide any assurances as to the accuracy of any information in this solicitation. Any reliance on these contents,or on any permitted communications with City officials,shall be at the recipient's own risk. Proposers should rely exclusively on their own investigations,interpretations,and analyses.The solicitation is being provided by the City without any warranty or representation, express or implied,as to its content,its accuracy,or its completeness. No warranty or representation is made by the City or its agents that any Proposal conforming to these requirements will be selected for consideration,negotiation,or approval. The City shall have no obligation or liability with respect to this solicitation,the selection and the award process,or whether any award will be made.Any recipient of this solicitation who responds hereto fully acknowledges all the provisions of this Disclosure and Disclaimer,is totally relying on this Disclosure and Disclaimer,and agrees to be bound by the terms hereof.Any Proposals submitted to the City pursuant to this solicitation are submitted at the sole risk and responsibility of the party submitting such Proposal. This solicitation is made subject to correction of errors, omissions,or withdrawal from the market without notice. Information is for guidance only,and does not constitute all or any part of an agreement. The City and all Proposers will be bound only as, if and when a Proposal (or Proposals), as same may be modified, and the applicable definitive agreements pertaining thereto, are approved and executed by the parties, and then only pursuant to the terms of the definitive agreements executed among the parties.Any response to this solicitation may be accepted or rejected by the City for any reason,or for no reason,without any resultant liability to the City. The City is governed by the Government-in-the-Sunshine Law,and all Proposals and supporting documents shall be subject to disclosure as required by such law. All Proposals shall be submitted in sealed proposal form and shall remain confidential to the extent permitted by Florida Statutes, until the date and time selected for opening the responses. At that time, all documents received by the City shall become public records. Proposers are expected to make all disclosures and declarations as requested in this solicitation.By submission of a Proposal,the Proposer acknowledges and agrees that the City has the right to make any inquiry or investigation it deems appropriate to substantiate or supplement information contained in the Proposal,and authorizes the release to the City of any and all information sought in such inquiry or investigation. Each Proposer certifies that the information contained in the Proposal is true, accurate and complete, to the best of its knowledge, information,and belief. Notwithstanding the foregoing or anything contained in the solicitation,all Proposers agree that in the event of a final unappealable judgment by a court of competent jurisdiction which imposes on the City any liability arising out of this solicitation, or any response thereto, or any action or inaction by the City with respect thereto,such liability shall be limited to$10,000.00 as agreed-upon and liquidated damages.The previous sentence, however, shall not be construed to circumvent any of the other provisions of this Disclosure and Disclaimer which imposes no liability on the City. In the event of any differences in language between this Disclosure and Disclaimer and the balance of the solicitation,it is understood that the provisions of this Disclosure and Disclaimer shall always govern.The solicitation and any disputes arising from the solicitation shall be governed by and construed in accordance with the laws of the State of Florida. ITB 2017-039-IC 22 PROPOSER CERTIFICATION I hereby certify that: I, as an authorized agent of the Proposer, am submitting the following information as my firm's proposal; Proposer agrees to complete and unconditional acceptance of the terms and conditions of this document, inclusive of this solicitation,all attachments,exhibits and appendices and the contents of any Addenda released hereto, and the Disclosure and Disclaimer Statement; Proposer agrees to be bound to any and all specifications, terms and conditions contained in the solicitation, and any released Addenda and understand that the following are requirements of this solicitation and failure to comply will result in disqualification of proposal submitted; Proposer has not divulged, discussed,or compared the proposal with other Proposers and has not colluded with any other Proposer or party to any other proposal; Proposer acknowledges that all information contained herein is part of the public domain as defined by the State of Florida Sunshine and Public Records Laws;all responses,data and information contained in this proposal, inclusive of the Proposal Certification,Questionnaire and Requirements Affidavit are true and accurate. Name of Proposer's Authorized Representative: Title of Proposer's Authorized Representative: Signature of Proposer's Authorized Representative: Date: State of ) On this_day of ,20_,personally ) appeared before me who County of ) stated that (s)he is the of , a corporation, and that the instrument was signed in behalf of the said corporation by authority of its board of directors and acknowledged said instrument to be its voluntary act and deed. Before me: Notary Public for the of My Commission Expires: ITB 2017-039-)C 23 APPENDIX B MI AM I BEACH " No Bid " Form ITB 2017-039-JC Plumbing Services PROCUREMENT DEPARTMENT 1755 Meridian Ave. 3rd Floor Miami Beach, Florida 33139 Note: It is important for those vendors who have received notification of this solicitation but have decided not to respond, to complete and submit the attached "Statement of No Bid." The "Statement of No Bid" provides the City with information on how to improve the solicitation process. Failure to submit a "Statement of No Bid" may result in not being notified of future solicitations by the City. ITB 2017-039-JC 24 Statement of No Bid WE HAVE ELECTED NOT TO SUBMIT A PROPOSAL AT THIS TIME FOR REASON(S) CHECKED AND/OR INDICATED BELOW: Workload does not allow us to proposal Insufficient time to respond Specifications unclear or too restrictive Unable to meet specifications Unable to meet service requirements Unable to meet insurance requirements Do not offer this product/service _OTHER. (Please specify) We do_do not_want to be retained on your mailing list for future proposals of this type product and/or service. Signature: Title: Legal Company Name: Note: Failure to respond, either by submitting a proposal or this completed form, may result in your company being removed from our vendors list. PLEASE RETURN TO: CITY OF MIAMI BEACH PROCUREMENT DEPARTMENT ATTN: Jason Crouch, Procurement Contracting Officer II PROPOSAL#2017-039-JC 1755 Meridian Ave. 3rd Floor MIAMI BEACH, FL 33139 ITB 2017-039-)C 25 APPENDIX C CA MIAMI B EACH Minimum & Specifications ITB 2017-039-JC Plumbing Services PROCUREMENT DEPARTMENT 1755 Meridian Ave. 3rd Floor Miami Beach, Florida 33139 ITB 2017-039-)C 26 1. Minimum Eligibility Requirements. The Minimum Eligibility Requirements for this solicitation are listed below. Bidder shall submit, with its bid or upon request by the City, the required submittal(s) documenting compliance with each minimum requirement. Proposers that fail to include the required submittals with its bid or fail to comply with minimum requirements shall be deemed non-responsive and shall not have its bid considered. The stated minimum requirements shall be applicable during the duration of the contract. 1. Bidder(firm) must be certified as plumbing contractor by Miami Dade County. Submittal Requirement: Bidder shall submit with its bid,or upon request by the Contracting Officer,a copy of the required license. 2. General Work Requirements. All work shall be performed in accordance with generally accepted industry principles, standards and practices, including (but not limited to the Uniform Plumbing Code and the South Florida Building Code. Prices offered by the successful bidder shall include(but not be limited to)all services, parts, labor, materials,equipment supervision, applicable taxes, employee expenses, profit and overhead as required to complete the work. The City may utilize any award resulting from this ITB to: 1) address or correct various routine plumbing requirements(on a time and materials basis, including parts, labor, materials, equipment and supervision, on an "as needed" basis, for emergency and non-emergency repairs; or 2) participate in a pool of prequalified plumbing contractors for planned repairs and projects. The services that may be acquired under the resulting contract include, but are not limited to, the following: 1. Installation, repairs,or modification to water,sewer,and drain lines; 2. Installation, repairs,or modification to storm drains and roof drains; 3. Cleaning and unstopping of storm drains, roof drains, trench drains, sanitary drainage systems, storm drainage systems, and drain fields for the beach showers; 4. Installation, repairs, or modification on a variety of bathrooms, i.e., sinks, showers, toilets, urinals, hot water heaters, well pumps, holding tanks, drains, trench drains, beach showers, and sand interceptors for the beach showers; 5. Installation, repairs, or modification on a variety of kitchens, i.e., dishwashers, drains and kitchen appliances that pertain to plumbing; 6. Installation and repairs to gas pipes, pipe insulation,and heat tap; 7. Pump-out and removal of contents from grease traps, sand oil interceptors, sand interceptors for the beach showers, and the decontamination tank at the fire stations. Once the contents are removed, the contractor is responsible for disposing the contents according to the regulations of Miami Dade County and the City of Miami Beach Department of Environmental Resources Management(D.E.R.M.); and 8. Installation, repair,or modification to water and drain lines for the fountains Citywide. 9. The installation, repair, and certification of Backflow Preventers of all types to insure the safely of the City of Miami Beach water supply system. The Backflow Preventer Certification certificate shall be given to the Contract Manager. 10.Any other applicable project requiring the services of a plumbing contractor. ITB 2017-039-)C 27 Tasks shall not be construed to represent any amount which the City shall be obligated to purchase under the contract, or relieve the Bidder of his obligation to fill all orders placed by the City. No bid will be considered which stipulates that the City guarantees to order a specific quantity of any service. 2.1 Permits. Contractor shall be responsible for attaining permits for any work which requires permits. The City will reimburse the contractor 100% of the cost of the permits only. No administrative fee is allowed to be assessed to the cost of the permits. Costs for re-inspections will not be reimbursed. 2.2 Parts and Supplies. It shall be the responsibility of the contractor to supply all necessary tools, equipment and transportation to perform the work as requested. If a contractor has to send a technician to a tool rental warehouse or a supply house to get material to finish a specific job for the City, and the contractor has 2 or more technicians working on this specific job, the contractor cannot charge the City for men waiting for the technician to return from the tool rental warehouse or the supply house. From time to time, the City reserves the right to provide supplies, materials or parts necessary for the work performed by the contractor. 2.3 Purchase Orders. A Purchase Order is required for all work. All invoices shall reflect the accurate Purchase Order number. Failure to do so will result in rejection of invoice. 3. Roadmap for Projects Awarded on a Time and Materials Basis. The City may award work on a time and materials basis in accordance with Section 0200, Sub-Section 14, Multiple Award. City departments may request Purchase Orders to be issued to the primary vendor for any group on a time and material basis (bid hourly charges plus discounted parts or materials) for a specific request or for a pre-need encumbrance (blanket order). Pursuant to Section 0200, General Condition 14, entitled Multiple Awards, secondary and primary vendors may also be considered. 3.1 Work Day. For billing purposes, regular working hours are from 7:00 a.m. to 5:00 p.m., Monday through Friday. Calls outside these hours and days will be considered non-regular. 3.2 Scheduling/Response Time. Response time requirements shall be as follows: 3.2.1 Emergency Repairs/Service. Work shall commence within two (2) hours of verbal or written notification by the project/contract manager.Work may be required 24 hours day, 7 Days a week, 365 Days a year, including holidays. 3.2.2 Non-Emergency Work. Work shall commence within 48 hours of written notification by the project/contract manager. ITB 2017-039-JC 28 3.3 Administrative Mark-up for Parts. For parts and materials ordered under this option, vendors shall provide quotes or invoice,as determined by the Contract Manager, based on the cost of parts and materials plus the agreed to mark-up. In determining cost of materials to which the mark-up may be applied,the contracting officer may: i. require the vendor to provide actual cost of parts and materials(e.g.,contractor's invoice, MSRP, etc.)prior to the issuance of a Purchase Order or approval of an invoice;or ii. may require the vendor to seek and document competition from its sources for the required parts or materials;or ii. may obtain any data are available from primary or other secondary sources and use that data in determining a fair and reasonable price. The cost of any ancillary third-party services that are provided by the vendor, with prior approval of the Contract Manager, may be determined in the manner prescribed above. 3.2. Estimates. The project/contract manager may require the contractor to provide an estimate prior to the commencement of work. Any actual charges that exceed estimate amounts must be pre-approved by the project/contract manager. 4. Roadmap for Projects Awarded Pursuant to Pool of Prequalified Contractors. In lieu of a time and materials order, the project/contract manager may request quotes from contractors authorized to participate in the Pre-Qualified Bidder Pool for larger repair projects or other planned projects. Responsive, responsible bidders (awarded or not) are eligible to participate in the Pre- Qualified Bidder Pool, at the discretion of the bidder and as indicated on the Cost Proposal Form at the time of submission. At its own expense,the contractor shall visit the site and prepare a detailed hourly rate bid, based on the contractors contract rates for accomplishing the work. Each bid prepared by the contractor shall include an acceptable description of the nature, extent and character of the work required, as well as performance and delivery schedules. In this case, projects may be awarded on a Lump Sum or Time and Material basis as determined by the project/contract manager. 4.1 For projects with an estimated cost up to $50,000, the project/contract manager may solicit written or telephone quotes prior to requesting a Purchase Order be issued for the work. 4.2 For projects with an estimated cost exceeding $50,000, the project/contract manager may solicit written quotes. Prior to issuing a Purchase Order for projects in this category, the City Manager's approval is required. 4.3 In determining the lowest and best contractor for the project, in addition to price, there shall be considered the following: (1)The ability, capacity and skill of the bidder to perform the contract. (2)Whether the bidder can perform the contract within the time specified,without delay or interference. (3)The character, integrity, reputation,judgment, experience and efficiency of the bidder. (4)The quality of performance of previous contracts. (5)The previous and existing compliance by the bidder with laws and ordinances relating to the contract. The City Manager's approval is required when the contractor offering the lowest cost is not selected. ITB 2017-039-IC 29 5. PERFORMANCE AND/OR PAYMENT BOND: Performance and payment bond, in the full amount of the value of the project, will be required for projects exceeding $200,000. Refer to Section 0200, Instructions to Bidders, 24. Bid Bonds, Performance Bonds, and Certificates of Insurance. Within seven (7) calendar days of notification by the City, Contractor shall furnish a Performance Bond from an A-rated Financial Class V Surety Company. If the vendor fails to deliver the bond within this specified time the City shall declare the vendor in default of the contractual terms and conditions, and the City shall not accept any offer from that vendor for a twelve (12) month period following such default. The following specifications shall apply to any bond provided: A. All bonds shall be written through surety insurers authorized to do business in the State of Florida as surety, with the following qualifications as to management and financial strength according to the latest edition of Bests Insurance Guide, published by A.M. Best Company, Oldwick, New Jersey: Bond Amount Best Rating 500,001 to 1,500,000 B V 1,500,001 to 2,500,000 A VI 2,500,001 to 5,000,000 A VII 5,000,001 to 10,000,000 A VIII Over 10,000,000 A IX B. On contract amounts of $500,000 or less, the bond provisions of Section 287.0935, Florida Statutes (1985) shall be in effect and surety companies not otherwise qualifying with this paragraph may optionally qualify by: 1. Providing evidence that the surety has twice the minimum surplus and capital required by the Florida Insurance Code at the time the solicitation is issued; 2. Certifying that the surety is otherwise in compliance with the Florida Insurance Code;and 3. Providing a copy of the currently valid Certificate of Authority issued by the United States Department of the Treasury under SS. 31 USC 9304-9308. Surety insurers shall be listed in the latest Circular 570 of the U.S. Department of the Treasury entitled"Surety Companies Acceptable on Federal Bonds", published annually. The bond amount shall not exceed the underwriting limitations as shown in this circular. C. For contracts in excess of 500,000 the provisions of Section B will be adhered to plus the company must have been listed for at least three consecutive years, or holding a valid Certificate of Authority of at least 1.5 million dollars and on the Treasury List. D. Surety Bonds guaranteed through U.S. Government Small Business Administration or Contractors Training and Development Inc. will also be acceptable. ITB 2017-039-JC 30 E. In lieu of a bond, an irrevocable letter of credit or a cash bond in the form of a certified cashier's check made out to the City of Miami Beach, Florida, will be acceptable. All interest will accrue to the City during the life of this contract and/or as long as the funds are being held by the City. F. Bond(s)shall be recorded in the public records of Miami-Dade County and provide City with evidence of such recording. It shall be the responsibility of all awarded vendors to be regularly informed to conform to any changes in standards issued by any regulatory agencies that govern the commodities or services applicable to this solicitation during the term of the contract. 1TB 2017-039-JC 31 APPENDIX D 0. MIAMI BBEACH Special Conditions ITB 2017-039-JC Plumbing Services PROCUREMENT DEPARTMENT 1755 Meridian Ave. 3rd Floor Miami Beach, Florida 33139 ITB 2017-039-JC 32 1. TERM OF CONTRACT: This contract shall remain in effect for three (3) years from date of contract execution by the Mayor and City Clerk. The City of Miami Beach has the option to renew the contract at the sole discretion of the City Manager for an additional two (2), one (1) year periods, on a year-to-year basis. Renewal of the contract is a City of Miami Beach prerogative, not a right of the Contractor. Such option will be exercised, if at all,only when it is in the best interest of the City of Miami Beach. In the event that the contract is held over beyond the term herein provided it shall only be from a month-to-month basis only and shall not constitute an implied renewal of the contract. Said month to month extension shall be upon the same terms of the contract and at the compensation and payment provided herein, and shall not exceed six(6) months. 2. PRICES SHALL BE FIXED AND FIRM FOR TERM OF CONTRACT: If the bidder is awarded a contract under this bid solicitation, the prices quoted by the bidder on the Bid Form shall remain fixed and firm during the three(3)year term of this contract; provided, however,that the bidder may offer incentive discounts from this fixed price to the City at any time during the contractual term. 2.1 OPTION TO RENEW WITH PRICE ADJUSTMENT: The contract could be extended for an additional two (2), one (1) year terms, on a year to year basis, at the sole discretion of the City Manager. Prior to completion of each exercised contract term, the City may consider an adjustment to price based on Consumer Price Index increase. Change shall not be more than the percentage increase or decrease in the Consumer Price Index CPI-U (all urban areas) computed 60 days prior to the anniversary date of the contract. It is the vendor's responsibility to request any pricing adjustment under this provision. For any adjustment to commence on the first day of any exercised option period, the vendor's request for adjustment should be submitted 60 days prior to expiration of the then current contract term. The vendor adjustment request must clearly substantiate the requested increase. If no adjustment request is received from the vendor, the City will assume that the vendor has agreed that the optional term may be exercised without pricing adjustment. Any adjustment request received after the commencement of a new option period may not be considered. 3. METHOD OF PAYMENT: Invoices for payment shall be submitted, no later than 3 business days after work has been performed, by the technician in the field to the Contracts Manager or a City representative who will verify time and material spent to complete a specific job. No down or partial down payments will be made. 4. SHIPPING TERMS: Prices shall include freight to City's premises, and shall be F.O.B. Destination. The successful bidder shall hold title to the goods until such time as they are delivered, installed and accepted by an authorized City representative. 5. DELIVERY REQUIREMENTS: The successful bidders shall enclose a complete packing slip or ITB 2017-039-JC 33 delivery ticket with any items to be delivered in conjunction with this bid solicitation. The packing slip shall be attached to the shipping carton(s)which contain the items and shall be made available to the City's authorized representative during delivery. The packing slip or delivery ticket shall include, at a minimum, the following information: purchase order number; date of order; and a complete listing of items being delivered. 6.BACK ORDER ALLOWANCES: If the vendor cannot deliver an ordered item in accordance with the scheduled delivery date due to a current existing backorder of that item with the vendor's manufacturer or distributor; the vendor shall insure that such back orders are filled within 21 calendar days from the initial scheduled delivery date for the item. The vendor shall not invoice the City for back ordered items until such back orders are delivered and accepted by the City's authorized representative. It is understood and agreed that the City may, at its discretion, verbally cancel back orders after the grace period identified in this paragraph has lapsed, seek the items from another vendor, and charge the incumbent vendor under this contract for any directly associated re-procurement costs. If the vendor fails to honor these re-procurement costs, the City may terminate the contract for default. 7. WARRANTY/GUARANTEE REQUIREMENTS: The contractor warrants the materials supplied and the work performed under this contract conform to warranty materials provided and work performed for one (1) year from date of completion. For new installations, contractor shall additionally provide full manufacturer warranty to the City. In addition to all other warranties that may be supplied by the bidder, the bidder shall warrant its products and/or service against faulty labor and/or defective material for a minimum period of one (1) year after the date of acceptance of the labor, materials and/or equipment by the City. This warranty requirement shall remain in force for the full one (1) year period; regardless of whether the contractor is under contract with the City at the time of the defect. Any payment by the City on behalf of the goods or services received from the contractor does not constitute a waiver of these warrant provisions. The contractor shall be responsible for promptly correcting any deficiency, at no cost to the City, within five (5) calendar days after the City notifies the contractor of such deficiency in writing. If the contractor fails to honor the warranty and/or fails to correct or replace the defective work or items within the period specified, the City may, at its discretion, notify the contractor, in writing, that the bidder may be debarred as a City bidder/proposer and/or subject to contractual default if the correction or replacements are not completed to the satisfaction of the City within ten (10)calendar days of receipt of the notice. If the contractor fails to satisfy the warranty within the period specified in the notice, the City may(a) place the contractor in default of the contract, and/or(b) procure the products or services from another contractor and charge the contractor for any additional costs that are incurred by the City for this work or items, either through a credit memorandum or through invoicing. 8. BACKGROUND CHECKS: The contractor shall conduct a full criminal background check at its own expense on each of its employees engaged in providing services under this ITB or any resulting Agreement prior to the commencement of said services. No contractor employee shall be eligible to perform services, pursuant to this ITB or resulting Agreement, if he or she: (1) has been convicted of or was placed in a pre-trial diversion program for any crime involving dishonesty or ITB 2017-039-IC 34 breach of trust; embezzlement; drug trafficking; forgery; burglary; robbery; theft; perjury; possession of stolen property; identity theft; fraud; money laundering; shoplifting; larceny; falsification of documents and/or (2) has been convicted of any sex, weapons, or violent crime including but not limited to homicide; attempted homicide; rape; child molestation; extortion; terrorism or terrorist threats; kidnapping; assault; battery; and illegal weapon possession, sale or use. The contractor shall defend, indemnify and hold the City, its officers, employees, and agents harmless from and against any and all liability, loss, expense(including reasonable attorneys'fees) or claims for injury or damages arising out of its failure to comply with this requirement. ITB 2017-039-JC 35 APPENDIX E tr-4- MIAMI BEACH Cost Proposal Form ITB 2017-039-JC Plumbing Services PROCUREMENT DEPARTMENT 1755 Meridian Ave. 3rd Floor Miami Beach, Florida 33139 ITB 2017-039-IC 36 APPENDIX E COST PROPOSAL FORM Failure to submit Cost Proposal Form in its entirety and fully executed by the deadline established for the receipt of proposals will result in proposal being deemed non-responsive and being rejected. Bidder affirms that the prices stated on the cost proposal form below represents the entire cost of the items in full accordance with the requirements of this ITB, inclusive of its terms, conditions, specifications and other requirements stated herein, and that no claim will be made on account of any increase in wage scales, material prices, delivery delays, taxes, insurance, cost indexes or any other unless a cost escalation provision is allowed herein and has been exercised by the City Manager in advance. The cost proposal form shall be completed mechanically or, if manually, in ink. Cost proposal forms completed in pencil shall be deemed non-responsive.All corrections on the cost proposal form shall be initialed. GROUP 1 TIME AND MATERIAL BASIS Total Item Description Quantity U/M Unit Cost (Quantity X_Unit Cost) EQUIPMENT,PARTS AND SERVICE Hourly Al Hourl Rate—Res ular 1600 Rate $ $ Hourly A2 Hourl Rate—Non Re.ular 400 Rate $ $ SUB-TOTAL—LABOR $ Estimated Annual %Mark—up Net Cost Gross Costs(Dealer (See Appendix (Dealer Invoice Item Description Invoice Cost) Section 3.1) Cost_X_%Mark-up) Administrative Mark-up for Parts and A3 Sup flies $50,000 % $ SUB-TOTAL—PARTS&EQUIPMENT $ GRAND TOTAL(ITEMS Al-A3) $ GROUP 2 POOL OF PREQUALIFIED CONTRACTORS Does bidder wish to be considered for Pool of Prequalified Contractors(See Appendix C, Section 4)? Note:Bidder shall be deemed responsive and responsible prior to be allowed to parficipate in Pool of Prequalified Contractors. Yes No Bidder's Affirmation Company: Authorized Representative: Address: Telephone: Email: Authorized Representative's Signature: ITB 2017-039-JC 37 APPENDIX F I MIAMBEACH Insurance Requirements ITB 2017-039-JC Plumbing Services PROCUREMENT DEPARTMENT 1755 Meridian Ave. 3rd Floor Miami Beach, Florida 33139 ITB 2017-039-JC 38 lb MIAMIBEACH INSURANCE REQUIREMENTS This document sets forth the minimum levels of insurance that the contractor is required to maintain throughout the term of the contract and any renewal periods. XXX 1. Workers'Compensation and Employer's Liability per the Statutory limits of the state of Florida. XXX 2. Comprehensive General Liability (occurrence form), limits of liability $ 1,000,000.00 per occurrence for bodily injury property damage to include Premises/ Operations; Products, Completed Operations and Contractual Liability. Contractual Liability and Contractual Indemnity (Hold harmless endorsement exactly as written in"insurance requirements"of specifications). XXX 3. Automobile Liability-$1,000,000 each occurrence-owned/non-owned/hired automobiles included. 4. Excess Liability-$ .00 per occurrence to follow the primary coverages. XXX 5. The City must be named as and additional insured on the liability policies; and it must be stated on the certificate. 6. Other Insurance as indicated: _Builders Risk completed value $ .00 Liquor Liability $ .00 _Fire Legal Liability $ .00 _Protection and Indemnity $ .00 Employee Dishonesty Bond $ .00 Other $ .00 XXX 7. Thirty(30)days written cancellation notice required. XXX 8. Best's guide rating B+:VI or better, latest edition. XXX 9. The certificate must state the proposal number and title The City of Miami Beach is self-insured. Any and all claim payments made from self-insurance are subject to the limits and provisions of Florida Statute 768.28, the Florida Constitution, and any other applicable Statutes. ITB 2017-039-JC 39 ATTACHMENT C CONSULTANTS RESPONSE TO THE ( ITB) INVITATION TO BID ( ITB) PLUMBING SERVICES 2017-039-JC BID ISSUANCE DATE: NOVEMBER 17, 2016 BID DUE: JANUARY 6, 2017 @ 3:00 PM ISSUED BY: MIAMIBEACH JASON CROUCH, PROCUREMENT CONTRACTING OFFICER PROCUREMENT DEPARTMENT 1755 Meridian Ave.3rd Floor, Miami Beach, FL 33139 305.673.7000, x6694) www,miamibeachfl.gov TABLE OF CONTENTS SOLICITATION SECTIONS: PAGE 0100 NOT UTILIZED NIA 0200 INSTRUCTIONS TO BIDDERS &GENERAL CONDITIONS 3 0300 BID SUBMITTAL INSTRUCTIONS & FORMAT 15 APPENDICES: APPENDIX A PROPOSAL CERTIFICATON, QUESTIONNAIRE AND AFFIDAVITS APPENDIX B "NO BID" FORM APPENDIX C MINIMUM REQUIREMENTS & SPECIFICATIONS APPENDIX D SPECIAL CONDITIONS APPENDIX E COST PROPOSAL FORM APPENDIX F INSURANCE REQUIREMENTS ITB 2017-039-JC 2 SECTION 0200 INSTRUCTIONS TO BIDDERS 1. GENERAL. This Invitation to Bid (ITB) is issued by the City of Miami Beach, Florida (the "City"), as the means for prospective Proposers to submit their qualifications, proposed scopes of work and cost proposals (the "bid") to the City for the City's consideration as an option in achieving the required scope of services and requirements as noted herein. All documents released in connection with this solicitation, including all appendixes and addenda, whether included herein or released under separate cover, comprise the solicitation, and are complementary to one another and together establish the complete terms,conditions and obligations of the Proposers and,subsequently, the successful Bidders(s) (the"contractor[s]") if this ITB results in an award. The City utilizes PublicPurchase (www.publicpurchase.com) for automatic notification of competitive solicitation opportunities and document fulfillment, including the issuance of any addendum to this ITB. Any prospective Bidder who has received this ITB by any means other than through PublicPurchase must register immediately with PublicPurchase to assure it receives any addendum issued to this ITB. Failure to receive an addendum may result in disqualification of proposal submitted. 2. PURPOSE. The City is seeking bids from qualified plumbing contractors to: 1) provide the City with various routine plumbing services on a time and materials basis, including parts, labor, materials, equipment and supervision on an "as needed" basis, including emergency repairs; or 2) participate in a pool of prequalified plumbing contractors for non- emergency or planned repairs and projects. The requirements and specifications are further detailed herein and, especially, in Appendix C. This ITB, and all subsequent work awarded pursuant to the ITB, shall comply with the City's Living Wage Law, as stipulated in the Code of the City of Miami Beach, Florida, Chapter 2, Article VI, Division 6, Sections 2-407—2-410. 3.SOLICITATIONTIMETABLE.The tentative schedule for this solicitation is as follows; ITB Issued November 17, 2016 Pre-Bid Meeting December 6, 2016 @ 11 a.m. (EST) Deadline for Receipt of Questions December 27, 2016 Responses Due January 6, 2017 @ 3;00 p.m. (EST) Tentative Commission Approval Authorizing Award TBD 4. PROCUREMENT CONTACT. Any questions or clarifications concerning this solicitation shall be submitted to the Procurement Contact noted below: Procurement Contact: Telephone: Email: Jason Crouch 305-673-7000,Ext.6694 'asoncrouch• miamibeachfl..ov Additionally, the City Clerk is to be copied on all communications via e-mail at: RafaelGranado(c�miamibeachfl.gov; or via facsimile: 786-394-4188. The Bid title/number shall be referenced on all correspondence. All questions or requests for clarification must be received no later than ten (10)calendar days prior to the date proposals are due as scheduled in Section 0200-3. All responses to questions/clarifications will be sent to all prospective Proposers in the form of an addendum. ITB 2017.039-JC 3 4. PRE-BID MEETING OR SITE VISIT(S). A Pre-Bid conference will be held as scheduled in Solicitation Timeline above at the following address: City of Miami Beach Procurement Department Conference Room C 1755 Meridian Ave.3rd Floor Miami Beach, Florida 33139 Attendance (in person or via telephone) is encouraged and recommended as a source of information, but is not mandatory. Proposers interested in participating in the Pre-Bid Submission Meeting via telephone must follow these steps: (1) Dial the TELEPHONE NUMBER: 1-888-270-9936 (Toll-free North America) (2) Enter the MEETING NUMBER: 9415468 Proposers who are interested in participating via telephone should send an e-mail to the contact person listed in this ITB expressing their intent to participate via telephone. 5. PRE-BID INTERPRETATIONS. Oral information or responses to questions received by prospective Bidders are not binding on the City and will be without legal effect, including any information received at pre-bid meeting or site visit(s). Only questions answered by written addenda will be binding and may supersede terms noted in this solicitation.Addendum will be released through PublicPurchase, 6. CONE OF SILENCE. Pursuant to Section 2-486 of the City Code, all procurement solicitations once advertised and until an award recommendation has been forwarded to the City Commission by the City Manager are under the "Cone of Silence." The Cone of Silence ordinance is available at http://library.municode.com/index.aspx?ciientlD=13097&statelD=9&statename=Florida. Any communication or inquiry in reference to this solicitation with any City employee or City official is strictly prohibited with the of exception communications with the Procurement Director, or his/her administrative staff responsible for administering the procurement process for this solicitation providing said communication is limited to matters of process or procedure regarding the solicitation. Communications regarding this solicitation are to be submitted in writing to the Procurement Contact named herein with a copy to the City Clerk at rafaelgranado@miamibeachfl.gov. 7. SPECIAL NOTICES. You are hereby advised that this solicitation is subject to the following ordinances/resolutions, which may be found on the City Of Miami Beach website: http://web.miamibeachfl.gov/procurement/Scroll.aspx?id=23510 • CONE OF SILENCE CITY CODE SECTION 2-486 • PROTEST PROCEDURES CITY CODE SECTION 2-371 • DEBARMENT PROCEEDINGS CITY CODE SECTIONS 2-397 THROUGH 2.485.3 • LOBBYIST REGISTRATION AND DISCLOSURE OF FEESCITY CODE SECTIONS 2-481 THROUGH 2-406 • CAMPAIGN CONTRIBUTIONS BY VENDORS CITY CODE SECTION 2-487 • CAMPAIGN CONTRIBUTIONS BY LOBBYISTS ON PROCUREMENT ISSUES CITY CODE SECTION 2-488 • REQUIREMENT FOR CITY CONTRACTORS TO PROVIDE EQUAL BENEFITS FOR DOMESTIC PARTNERS CITY CODE SECTION 2-373 • LIVING WAGE REQUIREMENT CITY CODE SECTIONS 2-407 THROUGH 2-410 • PREFERENCE FOR FLORIDA SMALL BUSINESSES OWNED AND CONTROLLED BY VETERANS AND TO STATE-CERTIFIED SERVICE- DISABLED VETERAN BUSINESS ENTERPRISES CITY CODE SECTION 2-374 • FALSE CLAIMS ORDINANCE CITY CODE SECTION 70-300 • ACCEPTANCE OF GIFTS,FAVORS&SERVICES , CITY CODE SECTION 2-449 82 1 3 4 8. EXAMINATION OF SOLICITATION DOCUMENTS AND SITE: It is the responsibility of each Bidder, before submitting a Bid, to: • Examine the solicitation thoroughly. • Visit the site or structure, as applicable, to become familiar with conditions that may affect costs, progress, performance or furnishing of the Work. • Take into account federal, state and local (City and Miami-Dade County) laws, regulations, permits, and ordinances that may affect costs, progress, performance,furnishing of the Work,or award. • Study and carefully correlate Bidder's observations with the solicitation. • Notify the Procurement Director of all conflicts, errors or discrepancies in the solicitation of which Bidder knows or reasonably should have known, • The submission of a Bid shall constitute an incontrovertible representation by Bidder that Bidder has complied with the above requirements and that without exception, the Bid is premised upon performing and furnishing the Work required by the solicitation and that the solicitation documents are sufficient in scope and detail to indicate and convey understanding of all terms and conditions for performance and furnishing of the Work. 9. POSTPONEMENT OF DUE DATE FOR RECEIPT OF BIDS. The City reserves the right to postpone the deadline for submittal of bids and will make a reasonable effort to give at least three (3) calendar days written notice of any such postponement to all prospective Bidders through PublicPurchase. 10. PROTESTS. Protests concerning the specifications, requirements, and/or terms; or protests after the bid due date in accordance with City Code Section 2-371, which establishes procedures for protested proposals and proposed awards. Protests not submitted in a timely manner pursuant to the requirements of City Code Section 2-371 shall be barred. 11. VETERAN BUSINESS ENTERPRISES PREFERENCE. Pursuant to City of Miami Beach Ordinance No. 2011- 3748, the City shall give a preference to a responsive and responsible bidder which is a small business concern owned and controlled by a veteran(s) or which is a service-disabled veteran business enterprise, and which is within five percent (5%) of the lowest and best bidder, by providing such bidder an opportunity of providing said goods or contractual services for the lowest responsive bid amount. Whenever, as a result of the foregoing preference, the adjusted prices of two (2)or more bidders which are a small business concern owned and controlled by a veteran(s) or a service-disabled veteran business enterprise constitute the lowest bid pursuant to an ITB or oral or written request for quotation, and such bids are responsive, responsible and otherwise equal with respect to quality and service, then the award shall be made to the service-disabled veteran business enterprise. 12. CONTRACT PRICE. Bid Price is to include the furnishing of all labor, materials, equipment including tools, services, permit fees, applicable taxes, overhead and profit for the completion of the Work except as may be otherwise expressly provided in the solicitation. ITB •17-0 •-C 5 13. METHOD OF AWARD. Following the review of bids and application of vendor preferences, the lowest responsive, responsible bidder(s) meeting all terms, conditions, and specifications of the ITB will be recommended for award by bid item, bid group, or for the entirety of all bid items, as deemed in the best interest of the City, to the City Manager for his consideration. After considering the staff recommendation for award, the City Manager shall exercise his due diligence and recommend to the Mayor and City Commission the bid that the City Manager deems to be in the best interest of the City. The City Commission shall consider the City Manager's recommendation(s)and, may approve or reject the City Manager's recommendation(s). The City Commission may also reject all bids received. In determining the lowest and best bidder, and in addition to price, Section 2-369 of the City Code provides that the City may consider the following: • The ability, capacity and skill of the bidder to perform the Contract. • Whether the bidder can perform the Contract within the time specified,without delay or interference. • The character, integrity, reputation,judgment, experience and efficiency of the bidder. • The quality of performance of previous contracts. • The previous and existing compliance by the bidder with laws and ordinances relating to the Contract. 14. MULTIPLE AWARD.The City may award up to three vendors(primary, secondary, tertiary), as available, by line item, by group or in its entirety. The City will endeavor to utilize vendors in order of award. However, the City may utilize other vendors in the event that: 1) a contract vendor is not or is unable to be in compliance with any contract or delivery requirement; 2) it is in the best interest of the City to do so regardless of reason. 15. BINDING CONTRACT. The signed bid shall be considered an offer on the part of the bidder, which offer shall be deemed accepted upon award of the bid by the City Commission. The City Commission's selection or approval of the City Manager's recommendation shall constitute a binding Contract between the City and the awarded bidder(s). The Contract shall include the solicitation, any and all addenda issued by the City and the Bid Proposal submitted the by bidder. In any discrepancy between the documents, the order of preference shall be as follows: 1)Addendum in reverse order of release; 2) Solicitation; 3) Bid Proposal. In case of default on the part of the successful bidder, the City may procure the items or services from other sources and hold the bidder responsible for any excess cost occasioned or incurred thereby. 16. VOLUME OF WORK TO BE RECEIVED BY CONTRACTOR. It is the intent of the City to purchase the goods and services specifically listed in this solicitation from the contractor. However, the City reserves the right to purchase any goods or services awarded from state or other governmental contract, or on an as-needed basis through the City's spot market purchase provisions. 17. GENERAL TERMS AND CONDITIONS. It is the responsibility of the Bidder to become thoroughly familiar with the Bid requirements, terms and conditions of this solicitation. Ignorance by the Bidder of conditions that exist or that may exist will not be accepted as a basis for varying the requirements of the City, or the compensation to be paid to the Bidder. 18. ACCEPTANCE OR REJECTION OF BIDS. The City reserves the right to reject any or all bids prior to award. Reasonable efforts will be made to either award the Contract or reject all bids within one-hundred twenty (120) calendar days after bid opening date. A Bidder may not withdraw its bid unilaterally nor change the Contract Price before the expiration of one hundred and twenty (120) calendar days from the date of bid opening. A Bidder may withdraw its bid after the expiration of one hundred twenty (120) calendar days from the date of bid opening by delivering written notice of withdrawal to the Procurement Department prior to award of the Bid by the Mayor and City Commission. 1 . . 01 ._•39 6 19. ALTERNATE RESPONSES MAY BE CONSIDERED. The City may consider one (1) alternate response from the same Bidder for the same formal solicitation; provided, that the alternate response offers a different product that meets or exceeds the formal solicitation requirements. In order for the City to consider an alternate response, the Bidder shall complete a separate Price Sheet form and shall mark "Alternate Response". Alternate response shall be placed in the same response. This provision only applies to formal solicitations for the procurement of goods, services, items,equipment, materials, and/or supplies. 20.AMERICAN WITH DISABILITIES ACT. To request this material in accessible format, sign language interpreters, information on access for persons with disabilities, and/or any accommodation to review any document or participate in any city-sponsored proceeding, please contact 305-604-2489 (voice), 305-673-7524 (fax) or 305-673-7218 (TTY) five days in advance to initiate your request.TTY users may also call 711 (Florida Relay Service). 21. ANTI-DISCRIMINATION. The bidder certifies that he/she is in compliance with the non-discrimination clause contained in Section 202, Executive Order 11246, as amended by Executive Order 11375, relative to equal employment opportunity for all persons without regard to race, color, religion, sex or national origin. 22. ASSIGNMENT. The successful bidder shall not assign, transfer, convey, sublet or otherwise dispose of the contract, including any or all of its right, title or interest therein, or his/her or its power to execute such contract, to any person, company or corporation, without the prior written consent of the City. 23.AUDIT RIGHTS AND RECORDS RETENTION.The Successful Bidder agrees to provide access at all reasonable times to the City, or to any of its duly authorized representatives, to any books, documents, papers and records of Contractor which are directly pertinent to this formal solicitation,for the purpose of audit,examination,excerpts, and transcriptions. The Successful Bidder shall maintain and retain any and all of the books, documents, papers and records pertinent to the Contract for three (3)years after the City makes final payment and all other pending matters are closed. Contractor's failure to or refusal to comply with this condition shall result in the immediate cancellation of this contract by the City. s® KININVOketilinI ,ll tt . MILVIR ;the l i Nditigt r P ' c'c IN. 'he bi h DIM n oTADCc ss I bidd r to s it. : rfq ice bond ' .: ertift€ to o l u nc inat MatIVOTODITOIN DAIRQUIR141 25. BILLING INSTRUCTIONS. Invoices, unless otherwise indicated, must show purchase order numbers and shall be submitted to the ordering City department. 26. CANCELLATION. In the event any of the provisions of this Bid are violated by the bidder, the City shall give written notice to the bidder stating such deficiencies and, unless such deficiencies are corrected within ten (10) calendar days from the date of the City's notice, the City, through its City Manager, may declare the contract in default and terminate same, without further notice required to the bidder. Notwithstanding the preceding, the City, through its City Manager, also reserves the right to terminate the contract at any time and for any reason, without cause and for convenience, and without any monetary liability to the City, upon the giving of thirty (30) days prior written notice to the bidder. 27. CITY'S RIGHT TO WAIVE OR REJECT BIDS. The City Commission reserves the right to waive any informalities or irregularities in this Bid; or to reject all bids, or any part of any bid, as it deems necessary and in the best interest of the City of Miami Beach. 28. CLARIFICATION AND ADDENDA TO BID SPECIFICATIONS. If a bidder is in doubt as to the true meaning of TB • -• 9-j 7 the Bid specifications, or other Bid documents, or any part thereof, the bidder must submit to the City, at least ten (10)calendar days prior to the scheduled Bid opening date, a request for clarification. Any interpretation of the Bid, including, without limitation, responses to questions and request for clarification(s)from bidders, will be made only by Addendum duly issued by the City. In the event of conflict with the original specifications, the Addendum shall supersede such specifications, to the extent specified. Subsequent Addendum shall govern over prior Addendum only to the extent specified. The bidder shall be required to acknowledge receipt of any and all Addendum, and filling in and signing in the spaces provided in section 5.0, Acknowledgements/Affidavits. Failure to acknowledge Addendum may deem a bid non-responsive. The City will not be responsible for explanations, interpretations, or answers to questions made verbally or in writing by any City representative, unless issued by the City via formal written Addendum to this Bid. Any questions or clarifications concerning the Bid shall be submitted in writing to the Procurement Department (DPM), 1755 Meridian Ave. 3rd Floor, Miami Beach, FL 33139 with a copy to the City Clerk. 29. COLLUSION.Where two(2) or more related parties each submit a bid or bids for any contract, such bids or bids shall be presumed to be collusive. The foregoing presumption may be rebutted by presentation of evidence as to the extent of ownership,control and management of such related parties in the preparation and submittal of such bid or bids. "Related parties" means bidders or the principals thereof which have a direct or indirect ownership interest in another bidder for the same contract, or in which a parent company or the principals thereof of one (1)bidder have a direct or indirect ownership interest in another bidder for the same contract. Bid or bids found to be collusive shall be rejected. Bidders who have been found to have engaged in collusion may also be suspended or debarred, and any contract resulting from collusive bidding may be terminated for cause. 30. CONDITION AND PACKAGING. Bidder guarantees items offered and delivered to be the current standard production model at time of bid and shall offer expiration dating of at least one year or later. Bidder also guarantees items offered and delivered to be new, unused, and free from any and all defects in material, packaging and workmanship and agrees to replace defective items promptly at no charge to the City of Miami Beach, for the manufacturer's standard warranty but in no case for a period of less than 12 months from date of acceptance. All containers shall be suitable for storage or shipment, and all prices shall include standard commercial packaging. 31. CONTRACT EXTENSION. The City reserves the right to require the Contractor to extend contract past the stated termination date for aperiod of upto 120 days in the event that a subsequent contract has not yet been Y q awarded. Additional extensions past the 120 days may occur as needed by the City and as mutually agreed upon by the City and the contractor. 32. DELIVERY. Unless actual date of delivery is specified (or if specified delivery cannot be met), show number of days (in calendar days) required to make delivery after receipt of purchase order, in space provided. Delivery time may become a basis for making an award. Delivery shall be within the normal working hours of the City using Department, Monday through Friday, excluding holidays. Receiving hours are Monday through Friday, excluding holidays,from 8:30 A.M.to 4:00 P.M. 33. DELIVERY TIME. Bidders shall specify in the attached Bid Form, the guaranteed delivery time(in calendar days) for each item. It must be a firm delivery time; no ranges(For example, 12-14 days)will be accepted. ITB 2O 1 ' 8 04 DEM-:4NSTF TIQN Q: O MPETENQY1 A. Pre-award inspection of the bidder's facility may be made prior to the award of contract. B. Bids will only be considered from firms which are regularly engaged in the business of providing the goods and/or services as described in this Bid. C. Bidders must be able to demonstrate a good record of performance for a reasonable period of time, and have sufficient financial capacity, equipment, and organization to ensure that they can satisfactorily perform the services if awarded a contract under the terms and conditions of this Bid. D. the terms "equipment and organization", as used herein shall, be construed to mean a fully equipped and well established company in line with the best business practices In the industry, and as determined by the City of Miami Beach. E. The City may consider any evidence available regarding the financial, technical, and other qualifications and abilities of a bidder, including past performance (experience), in making an award that is in the best interest of the City. F. The City may require bidders to show proof that they have been designated as authorized representatives of a manufacturer or supplier, which is the actual source of supply. In these instances, the City may also require material information from the source of supply regarding the quality, packaging, and characteristics of the products to be supply to the City. Any material conflicts between information provided by the source of supply and the information contained in the bidder's bid may render the bid non-responsive. G. The City may, during the period that the contract between the City and the successful bidder is in force, review the successful bidder's record of performance to ensure that the bidder is continuing to provide sufficient financial support, equipment, and organization as prescribed in this bid. Irrespective of the bidder's performance on contracts awarded to it by the City, the City may place said contracts on probationary status and implement termination procedures if the City determines that the successful bidder no longer possesses the financial support, equipment, and organization which would have been necessary during the bid evaluation period in order to comply with the demonstration of competency required under this subsection. 35. DISPUTES. In case of any doubt or difference of opinion as to the items and/or services (as the case may be)to be furnished hereunder, the decision of the City shall be final and binding on all parties. 36. DISPUTES. In the event of a conflict between the Bid documents, the order of priority of the documents shall be as follows: A. Any contract or agreement resulting from the award of this Bid;then B. Addendum issued for this Bid, with the latest Addendum taking precedence;then C. The Bid; then D. The bidder's bid in response to the Bid. 37. DEFAULT. Failure or refusal of a bidder to execute a contract upon award, or withdrawal of a bid before such award is made, may result in forfeiture of that portion of any bid surety required as liquidated damages incurred by the City thereby; or, where surety is not required, failure to execute a contract as described above may be grounds for removing the bidder from the City's bidders list. 38. EQUIVALENTS. If a bidder offers makes of equipment or brands of supplies other than those specified in the Bid specifications, he must so indicate in his bid. Specific article(s) of equipment/supplies shall conform in quality, design and construction with all published claims of the manufacturer. 2O1l 9 C 9 The bidder shall indicate in the Bid Form the manufacturer's name and number if bidding other than the specified brands, and shall indicate ANY deviation from the specifications as listed in the Bid. Other than specified Items offered requires complete descriptive technical literature marked to indicate detailed conformance with specifications, and MUST BE INCLUDED WITH THE BID. NO BIDS WILL BE CONSIDERED WITHOUT THIS INFORMATION. THE CITY SHALL BE THE SOLE JUDGE OF EQUALITY AND ITS DECISION SHALL BE FINAL. Note as to Brand Names: Catalog numbers, manufacturers' and brand names, when listed, are informational guides as to a standard of acceptable product quality level only and should not be construed as an endorsement or a product limitation of recognized and legitimate manufacturers. Bidders shall formally substantiate and verify that product(s) offered conform with or exceed quality as listed in the specifications. 39. ELIMINATION FROM CONSIDERATION. This bid shall not be awarded to any person or firm who is in arrears to the City upon any debt, taxes, or contracts which are defaulted as surety or otherwise upon any obligation to the City. 40. EMERGENCY RESPONSE PRIORITY. It is hereby made a part of this solicitation that before, during,and after a public emergency, disaster, hurricane, tornado, flood, or other acts of force majeure that the City of Miami Beach, Florida shall receive a "First Priority" for any goods and services covered under any award resulting from this solicitation, including balance of line items as applicable. It is vital and imperative that the majority of citizens are protected from any emergency situation that threatens public health and safety, as determined by the City. By virtue of submitting a response to this solicitation, vendor agrees to provide all award-related goods and services to the City on a"first priority" under the emergency conditions noted above. 41. ESTIMATED QUANTITIES. Estimated quantities or estimated dollars, if provided, are for City guidance only. No guarantee is expressed or implied as to quantities or dollars that will be used during the contract period. The City is not obligated to place any order for a given amount subsequent to the award of this Bid. Estimates are based upon the City's actual needs and/or usage during a previous contract period. The City may use said estimates for purposes of determining whether the low bidder meets specifications. 42. EXCEPTIONS TO BID. Bidders are strongly encouraged to thoroughly review the specifications and all conditions set forth in this Bid. Bidders who fail to satisfy the requirements in this Bid, may be deemed non- responsive and receive no further consideration. Should your proposed bid not be able to meet one (1) or more of the requirements set forth in this Bid and you are proposing alternatives and/or exceptions to said requirements, you must notify the Procurement Office, in writing, at least five (5) days prior to the deadline for submission of bids. The City reserves the right to revise the scope of services via Addendum prior to the deadline for receipt of bids. 43. FACILITIES.The City, through its City Manager or his/her authorized designee, reserves the right to inspect the bidder's facilities at any time, upon reasonable prior written or verbal notice. f ' b7- _7 --w lo 44. FLORIDA PUBLIC RECORDS LAW. Bidders are hereby notified that all Bid including, without limitation, any and all information and documentation submitted therewith, are exempt from public records requirements under Section 119.07(1), Florida Statutes, and s. 24(a), Art. 1 of the State Constitution until such time as the City provides notice of an intended decision or until thirty (30) days after opening of the bids, whichever is earlier. Additionally, Contractor agrees to be in full compliance with Florida Statute 119.0701 including, but not limited to, agreement to (a) Keep and maintain public records that ordinarily and necessarily would be required by the public agency in order to perform the services; (b) provide the public with access to public records on the same terms and conditions that the public agency would provide the records and at a cost that does not exceed the cost provided in this chapter or as otherwise provided by law; (c) Ensure that public records that are exempt or confidential and exempt from public records disclosure requirements are not disclosed except as authorized by law; (d) Meet all requirements for retaining public records and transfer, at no cost, to the public agency all public records in possession of the contractor upon termination of the contract and destroy any duplicate public records that are exempt or confidential and exempt from public records disclosure requirements. All records stored electronically must be provided to the public agency in a format that is compatible with the information technology systems of the public agency. 45. F.O.B. DESTINATION. Unless otherwise specified in the Formal Solicitation, all prices quoted/proposed by the bidder must be F.O.B. DESTINATION, inside delivery, with all delivery costs and charges included in the bid price, unless otherwise specified in this Formal Solicitation. Failure to do so may be cause for rejection of bid. 46. GRATUITIES. Bidders shall not offer any gratuities, favors, or anything of monetary value to any official, employee, contractor,or agent of the City, for the purpose of influencing consideration of this Bid. 47. INDEMNIFICATION. The successful Bidder shall indemnify and hold harmless the City and its officers, employees, agents and instrumentalities from any and all liability, losses or damages, including attorney's fees and costs of defense, which the City or its officers, employees, agents or instrumentalities may incur as a result of claims, demands, suits, causes of actions or proceedings of any kind or nature arising out of, relating to or resulting from the performance of the agreement by the successful Bidder or its employees, agents, servants, partners, principals or subcontractors. The successful Bidder shall pay all claims and losses in connection therewith, and shall investigate and defend all claims, suits or actions of any kind or nature in the name of the City, where applicable, including appellate proceedings, and shall pay all costs, judgments, and attorney's fees which may be incurred thereon. The successful Bidder expressly understands and agrees that any insurance protection required by this Agreement or otherwise provided by the successful Bidder shall in no way limit the responsibility to indemnify, keep and save harmless and defend the City or its officers, employees, agents and instrumentalities as herein provided. The above indemnification provisions shall survive the expiration or termination of this Agreement. 48. INSPECTION, ACCEPTANCE & TITLE. Inspection and acceptance will be at destination, unless otherwise provided. Title to (or risk of loss or damage to) all items shall be the responsibility of the successful bidder until acceptance by the City, unless loss or damage results from the gross negligence or willful misconduct of the City. If any equipment or supplies supplied to the City are found to be defective, or do not conform to the specifications, the City reserves the right to cancel the order upon written notice to the seller, and return the product, at the bidder's expense. 49. LAWSPERMITSAND REGULATIONS. The bidder shall obtain and pay for all licenses, permits, and inspection fees required under the contract; and shall comply with all Applicable Laws. 1I TB 017-1 •-JC 11 50. LEGAL REQUIREMENTS. The bidder shall be required to comply with all federal, State of Florida, Miami-Dade County, and City of Miami Beach codes, laws, ordinances, and/or rules and regulations that in any manner affect the items covered herein (collectively, Applicable Laws). Lack of knowledge or ignorance by the bidder with/of Applicable Laws will in no way be a cause for relief from responsibility. 51. LIABILITY, INSURANCE, LICENSES AND PERMITS. Where bidders are required to enter or go on to City of Miami Beach property to deliver materials or perform work or services as a result of the Bid, the bidder will assume the full duty, obligation and expense of obtaining all necessary licenses, permits, and insurance, and assure all work complies with all Applicable Laws. The bidder shall be liable for any damages or loss to the City occasioned by negligence of the bidder, or his/her officers, employees, contractors, and/or agents, for failure to comply with Applicable Laws. 52. MANNER OF PERFORMANCE. Bidder agrees to perform its duties and obligations in a professional manner and in accordance with all applicable Local, State, County, and Federal laws, rules, regulations and codes. Bidder agrees that the services provided shall be provided by employees that are educated, trained, experienced, certified, and licensed in all areas encompassed within their designated duties. Bidder agrees to furnish to the City any and all documentation, certification, authorization, license, permit, or registration currently required by applicable laws, rules, and regulations. Bidder further certifies that it and its employees will keep all licenses, permits, registrations, authorizations, or certifications required by applicable laws or regulations in full force and effect during the term of this contract. Failure of bidder to comply with this paragraph shall constitute a material breach of this contract, 53. MISTAKES. Bidders are expected to examine the specifications, delivery schedules, bid prices, and extensions, and all instructions pertaining to supplies and services. Failure to do so will be at the bidder's risk and may result in the bid being non-responsive. 54. MODIFICATION/WITHDRAWALS OF BIDS.A bidder may submit a modified bid to replace all or any portion of a previously submitted bid up until the bid due date and time. Modifications received after the bid due date and time will NOT be considered. Bids shall be irrevocable until contract award unless withdrawn in writing prior to the bid due date or after expiration of 120 calendar days from the opening of bids without a contract award. Letters of withdrawal received after the bid due date and before said expiration date and letters of withdrawal received after contract award will NOT be considered. 55. NON-CONFORMANCE TO CONTRACT CONDITIONS. Items may be tested for compliance with specifications. Items delivered, not conforming to specifications, may be rejected and returned at the bidder's expense. These items, as well as items not delivered as per delivery date in bid and/or purchase order, may be purchased by the City, at its discretion, on the open market. Any increase in cost may be charged against the bidder. Any violation of these stipulations may also result in the bidder's name being removed from the City's vendor list. 56. OPTIONAL CONTRACT USAGE. When the successful bidder(s) is in agreement, other units of government or non-profit agencies may participate in purchases pursuant to the award of this contract at the option of the unit of government or non-profit agency. 57. OSHA. The bidder warrants to the City that any work, services, supplies, materials or equipment supplied pursuant to this Bid shall conform in all respects to the standards set forth in the Occupational Safety and Health Act of 1970, as amended, and the failure to comply with this condition will be deemed breach of contract. Any fines levied because of inadequacies to comply with this condition shall be borne solely by the bidder. ") 12 ql 58. PATENTS & ROYALTIES.The bidder shall indemnify and save harmless the City of Miami Beach, Florida, and its officers, employees, contractors, and/or agents, from liability of any nature or kind, including cost and expenses for, or on account of, any copyrighted, patented,or unpatented invention, process,or article manufactured or used in the performance of the contract, including its use by the City of Miami Beach, Florida. If the bidder uses any design, device or materials covered by letters, patent, or copyright, it is mutually understood and agreed, without exception, that the bid prices shall include all royalties or cost arising from the use of such design, device, or materials in any way involved in the work. 59. PAYMENT. Payment will be made by the City after the items have been received, inspected, and found to comply with Bid specifications,free of damage or defect, and properly invoiced. 60. PRICES QUOTED. Prices quoted shall remain firm and fixed during the duration of the contract. In completing the bid form, state both unit price and extended total, when requested. Prices must be stated in units of quantity specified in the bidding specifications. In case of discrepancy in computing the amount of the bid, the UNIT PRICE quoted will govern. All prices must be F.O.B. destination, freight prepaid (unless otherwise stated in Special Conditions). The Bidder may offer cash discounts for prompt payments; however, such discounts will not be considered in determining the lowest price during bid evaluation. Bidders are requested to provide prompt payment terms in the space provided on the Bid submittal signature page of the solicitation. Award, if made, will be in accordance with terms and conditions stated herein. Each item must be bid separately, and no attempt is to be made to tie any item or items in with any other item or items. Cash or quantity discounts offered will not be a consideration in determination of award of bid(s). 61. PRODUCT INFORMATION. Product literature, specifications, and technical information, including Manufacturer's Safety Data Sheets(MSDS) should be provided with this bid as an attachment to the "BID FORM". However, in all cases must be provided within five(5)calendar days upon request from Purchasing Agent. 62. REASONABLE ACCOMMODATION. In accordance with Title II of the Americans with Disabilities Act, any person requiring an accommodation at the Bid opening because of a disability must contact the Procurement Division. 63. SAMPLES. Bids submitted as an "equal" product must be accompanied with detailed specifications. Samples of items, when required, must be furnished free of expense and, if not destroyed, will, upon request, be returned at the bidder's expense. Bidders will be responsible for the removal of all samples furnished within (30) days after bid opening. All samples will be disposed of after thirty (30) days. Each individual sample must be labeled with the bidder's name. Failure of the bidder to either deliver required samples,or to clearly identify samples may be reason for rejection of the bid. Unless otherwise indicated, samples should be delivered to the Procurement Division, 1755 Meridian Ave. 3rd Floor, Miami Beach, FL 33139. 64. SPECIAL CONDITIONS. Any and all Special Conditions that may vary from these General Terms and Conditions shall have precedence. 65. SPOT MARKET PURCHASES. It is the intent of the City to purchase the items specifically listed in this Bid from the successful bidder. However, the City reserves the right to purchase the items from state or other governmental contract, or on an as-needed basis through the City's spot market purchase provisions. -g 01 _• 13 Solicitation No: Solicitation Title: 2017-039-JC Plumbing Services Procurement Contact: Tel: Email: Jason Crouch 305-673-7000 x7490 jasoncrouch@mlamibeachfl.gov PROPOSAL CERTIFICATION, QUESTIONNAIRE&REQUIREMENTS AFFIDAVIT Purpose: The purpose of this Proposal Certification, Questionnaire and Requirements Affidavit Form is to inform prospective Proposers of certain solicitation and contractual requirements, and to collect necessary information from Proposers in order that certain portions of responsiveness, responsibility and other determining factors and compliance with requirements may be evaluated. This Proposal Certification, Questionnaire and Requirements Affidavit Form is a REQUIRED FORM that must be submitted fully completed and executed. 1. General Proposer Information. FIRM NAME: Haber&Son's Plumbing,Inc. No of Years in Business: 18+Years No of Years In Business Locally: No.of Employees: 18 Years 5 OTHER NAME(S)PROPOSER HAS OPERATED UNDER IN THE LAST 10 YEARS: None FIRM PRIMARY ADDRESS(HEADQUARTERS): 4106 Northwest 37th Avenue CITY: Miami STATE: FL ZIP CODE: 33142 TELEPHONE NO.: 305-461-8653 TOLL FREE NO.: FAX No.; 305-567-9976 FIRM LOCAL ADDRESS; 4106 Northwest 37th Avenue CITY: Miami STATE: FL ZIP CODE: 33142 PRIMARY ACCOUNT REPRESENTATIVE FOR THIS ENGAGEMENT: Jose Haber/Office Staff ACCOUNT REP TELEPHONE NO.: 305-461-8653 ACCOUNT REP TOLL FREE NO.: ACCOUNT REP EMAIL Haberandplumbing@bellsouth.net FEDERAL TAX IDENTIFICATION NO.: 65-0845989 The City reserves the right to seek additional Information from Proposer or other source(s),including but not limited to: any firm or principal information, applicable licensure,resumes of relevant individuals,client information,financial information,or any information the City deems necessary to evaluate the capacity of the Proposer to perform in accordance with contract requirements. TB201 _ 18 1. Veteran Owned Business.Is Pro oser claiming a veteran owned business status? YES X NO SUBMITTAL REQUIREMENT: Proposers claiming veteran owned business status shall submit a documentation proving that firm is certified as a veteran-owned business or a service-disabled veteran owned business by the State of Florida or United States federal government,as required pursuant to ordinance 2011-3748. 2. Fit nc(at. 3pabity.g(ch r p h 11 rr r e.fat.D rr .Br d kr tt V tAI?t! IMMIRMi R ( QNirectlY:t tl, .ejr ir it t,C 1 a omm No proposal will be considered without receipt,by the City,of the SQR directly from Dun & Bradstreet. The cost of the preparation of the SQR shall be the responsibility of the Proposer.Ttrk Ptdpas f° talMe Vitt R f T l ft i'1"t I :B=11 11, girth til ftal drib:ddii 1 teba '1 ff Sl$t rMit f It tISt011O P, t tl7titf5 el #1161:x. FE*P s a A$P p14 13 qU ¢ Mkt. .t of atj tC 0taJflod, .t; MRa 1 ;;1 HI1 lY t' OM MIO4 M ti FOOTHINNEtitrAteNettleittittaillinginnatbettatatailgantlANDIRININUOMION1 t t . `it, tl. 1i r si F4 l0ta a i7vitic a tOi f t .&Q n lfi11f 1 1 . R4 t A : fi at t frOERMAR : MJTT" qUt MENLINIMPOIRMILDI L<Cian. 4.redetrt.tt,(ubl ttt . piWr:Qvi lifiertl e ot'dt4 tIY.t&P ) I : itt�et ?IShldtt rre ?get• 3. Conflict Of Interest.All Proposers must disclose,in their Proposal,the name(s)of any officer,director,agent,or immediate family member(spouse, parent, sibling, and child) who is also an employee of the City of Miami Beach, Further, all Proposers must disclose the name of any City employee who owns, either directly or indirectly, an interest of ten (10%) percent or more in the Proposer entity or any of its affiliates. SUBMITTAL REQUIREMENT: Proposers must disclose the name(s) of any officer, director, agent, or immediate family member (spouse,parent,sibling,and child)who is also an employee of the City of Miami Beach. Proposers must also disclose the name of any City employee who owns,either directly or indirectly,an interest of ten(10%)percent or more in the Proposer entity or any of its affiliates. 4. References&Past Performance.Rr d$1r h lLIVISj t tfit (3)ret e e_1*r NINt Pro tfa r)a a7pl t d We l( 011111011MILIUMBINIKINCOUtTentgl SUBMITTAL REQUIREMENTS RNM efq)' r G l d it the f lleVtK.It)fet> lfet1 K M.,'LIFIhl:ISJ l; 2} p fact I f letf is .r e BS T.JN)Aetlr e 4)►`a.� h'ri)Q li .qtf). Il6td. ?_LABII tiVi elTK `.P C E3 1 t 5. Suspension,Debarment or Contract Cancellation.Has Proposer ever been debarred,suspended or other legal violation,or had a contract cancelled due to non- erformance by an ,ublic sector agency? I YES © NO SUBMITTAL REQUIREMENT: If answer to above is "YES,"Proposer shall submit a statement detailing the reasons that led to action(s). 6. Vendor Campaign Contributions. Proposers are expected to be or become familiar with, the City's Campaign Finance Reform laws, as codified in Sections 2-487 through 2-490 of the City Code. Proposers shall be solely responsible for ensuring that all applicable provisions of the City's Campaign Finance Reform laws are complied with,and shall be subject to any and all sanctions, as prescribed therein,including disqualification of their Proposals,in the event of such non-compliance. SUBMITTAL REQUIREMENT: Submit the names of all individuals or entities (including your sub-consultants) with a controlling financial interest as defined in solicitation. For each individual or entity with a controlling financial interest indicate whether or not each individual or entity has contributed to the campaign either directly or indirectly,of a candidate who has been elected to the office of Mayor or City Commissioner for the City of Miami Beach. 7, Code of Business Ethics.Pursuant to City Resolution No,2000-23879,each person or entity that seeks to do business with the City shall adopt a Code of Business Ethics("Code")and submit that Code to the Procurement Division with its proposal/response or within five (5)days upon receipt of request. The Code shall, at a minimum, require the Proposer,to comply with all applicable governmental rules and regulations including, among others, the conflict of interest, lobbying and ethics provision of the City of I B 7- 19 Miami Beach and Miami Dade County. SUBMITTAL REQUIREMENT: Proposer shall submit firm's Code of Business Ethics. In lieu of submitting Code of Business Ethics, Proposer may submit a statement indicating that it will adopt,as required in the ordinance,the City of Miami Beach Code of Ethics,available at www.miamibeachfl.gov/procurement/. 8. Living Wage.Pursuant to Section 2-408 of the Miami Beach City Code, as same may be amended from time to time,Proposers shall be required to pay all employees who provide services pursuant to this Agreement,the hourly living wage rates listed below: • Commencing with City fiscal year 2012-13(October 1, 2012),the tl tlt'Iy.lI9ing,f t 111,7e$iI 2Ih .V1tt .tlj f lte of at least$1.69,and Paltnitifatiettet The living wage rate and health care benefits rate may, by Resolution of the City Commission be indexed annually for inflation using the Consumer Price Index for all Urban Consumers(CPI-U)Miami/Ft.Lauderdale,issued by the U.S.Department of Labor's Bureau of Labor Statistics. Notwithstanding the preceding,no annual index shall exceed three percent(3%).The City may also,by resolution,elect not to index the living wage rate in any particular year,if it determines it would not be fiscally sound to implement same(in a particular year). Proposers'failure to comply with this provision shall be deemed a material breach under this proposal,under which the City may, at its sole option, immediately deem said Proposer as non-responsive, and may further subject Proposer to additional penalties and fines, as provided in the City's Living Wage Ordinance, as amended. Further information on the Living Wage requirement is available at www.miamibeachfl.gov/procurement/. SUBMITTAL REQUIREMENT: No additional submittal is required. By virtue of executing this affidavit document, Proposer agrees to the living wage requirement. 9. Equal Benefits for Employees with Spouses and Employees with Domestic Partners. When awarding competitively solicited contracts valued at over$100,000 whose contractors maintain 51 or more full time employees on their payrolls during 20 or more calendar work weeks,the Equal Benefits for Domestic Partners Ordinance 2005-3494 requires certain contractors doing business with the City of Miami Beach, who are awarded a contract pursuant to competitive proposals,to provide"Equal Benefits"to their employees with domestic partners, as they provide to employees with spouses. The Ordinance applies to all employees of a Contractor who work within the City limits of the City of Miami Beach,Florida;and the Contractor's employees located in the United States, but outside of the City of Miami Beach limits, who are directly performing work on the contract within the City of Miami Beach. A. Does your company provide or offer access to any benefits to employees with spouses or to spouses of employees? YES X NO B. Does your company provide or offer access to any benefits to employees with(same or opposite sex)domestic partners*or to domestic partners of employees? YES X NO C. Please check all benefits that apply to your answers above and list in the "other" section any additional benefits not already specified. Note: some benefits are provided to employees because they have a spouse or domestic partner,such as bereavement leave;other benefits are provided directly to the spouse or domestic partner,such as medical insurance. BENEFIT Firm Provides for Firm Provides for Firm does not Employees with Employees with Provide Benefit Spouses Domestic Partners Health X Sick Leave X Family Medical Leave X Bereavement Leave X If Proposer cannot offer a benefit to domestic partners because of reasons outside your control, (e.g., there are no insurance providers in your area willing to offer domestic partner coverage)you may be eligible for Reasonable Measures compliance. To comply on this basis, you must agree to pay a cash equivalent and submit a completed Reasonable Measures Application (attached)with all necessary documentation,Your Reasonable Measures Application will be reviewed for consideration by the City Manager,or his designee. Approval is not guaranteed and the City Manager's decision is final. Further information on the Equal Benefits requirement is available at www.miamibeachfl.gov/procurement/. ITB X17• •- 20 10. Public Entity Crimes.Section 287.133(2)(a),Florida Statutes,as currently enacted or as amended from time to time,states that a person or affiliate who has been placed on the convicted vendor list following a conviction for a public entity crime may not submit a proposal,bid,or reply on a contract to provide any goods or services to a public entity; may not submit a proposal,bid,or reply on a contract with a public entity for the construction or repair of a public building or public work;may not submit proposals,bids,or replies on leases of real property to a public entity;may not be awarded or perform work as a contractor,supplier,subcontractor,or consultant under a contract with any public entity; and may not transact business with any public entity in excess of the threshold amount provided in s.287.017 for CATEGORY TWO for a period of 36 months following the date of being placed on the convicted vendor list. SUBMITTAL REQUIREMENT: No additional submittal is required. By virtue of executing this affidavit document, Proposer agrees with the requirements of Section 287.133,Florida Statutes,and certifies it has not been placed on convicted vendor list. 11. Non-Discrimination.Pursuant to City Ordinance No.2016-3990,the City shall not enter into a contract with a business unless the business represents that it does not and will not engage in a boycott as defined in Section 2-375(a)of the City Code,including the blacklisting,divesting from, or otherwise refusing to deal with a person or entity when such action is based on race,color, national origin,religion,sex,intersexuality,gender identity,sexual orientation,marital or familial status,age or disability. SUBMITTAL REQUIREMENT: No additional submittal is required. By virtue of executing this affidavit document, Proposer agrees it is and shall remain in full compliance with Section 2-375 of the City of Miami Beach City Code. 12. Moratorium on Travel to and the Purchase of Goods or Services from North Carolina and Mississippi. Pursuant to Resolution 2016-29375, the City of Miami Beach, Florida, prohibits official City travel to the states of North Carolina and Mississippi, as well as the purchase of goods or services sourced in North Carolina and Mississippi. Proposer shall agree that no travel shall occur on behalf of the City to North Carolina or Mississippi,nor shall any product or services it provides to the City be sourced from these states. SUBMITTAL REQUIREMENT: No additional submittal is required. By virtue of executing this affidavit document,Proposer agrees it is and shall remain in full compliance with Resolution 2016-29375. 13. Acknowledgement of Addendum. After issuance of solicitation, the City may release one or more addendum to the solicitation which may provide additional information to Proposers or alter solicitation requirements, The City will strive to reach every Proposer having received solicitation through the City's e-procurement system, PublicPurchase.com. However, Proposers are solely responsible for assuring they have received any and all addendum issued pursuant to solicitation.This Acknowledgement of Addendum section certifies that the Proposer has received all addendum released by the City pursuant to this solicitation. Failure to obtain and acknowledge receipt of all addendum may result in proposal disqualification. Initial to Confirm Initial to Confirm Initial to Confirm Receipt Receipt Receipt Addendum 1 Addendum 6 Addendum 11 Addendum 2 Addendum 7 Addendum 12 Addendum 3 Addendum 8 Addendum 13 Addendum 4 Addendum 9 Addendum 14 Addendum 5 Addendum 10 Addendum 15 If additional confirmation of addendum is required,submit under separate cover. B2 1 J 21 DISCLOSURE AND DISCLAIMER SECTION The solicitation referenced herein is being furnished to the recipient by the City of Miami Beach (the"City")for the recipient's convenience. Any action taken by the City in response to Proposals made pursuant to this solicitation,or in making any award,or in failing or refusing to make any award pursuant to such Proposals, or in cancelling awards, or in withdrawing or cancelling this solicitation,either before or after issuance of an award,shall be without any liability or obligation on the part of the City. In its sole discretion,the City may withdraw the solicitation either before or after receiving proposals, may accept or reject proposals, and may accept proposals which deviate from the solicitation, as it deems appropriate and in its best interest. In its sole discretion,the City may determine the qualifications and acceptability of any party or parties submitting Proposals in response to this solicitation. Following submission of a Bid or Proposal, the applicant agrees to deliver such further details, Information and assurances, including financial and disclosure data, relating to the Proposal and the applicant including, without limitation, the applicant's affiliates, officers, directors,shareholders,partners and employees,as requested by the City in its discretion. The information contained herein is provided solely for the convenience of prospective Proposers. It is the responsibility of the recipient to assure itself that information contained herein is accurate and complete.The City does not provide any assurances as to the accuracy of any information in this solicitation. Any reliance on these contents,or on any permitted communications with City officials,shall be at the recipient's own risk. Proposers should rely exclusively on their own investigations,interpretations,and analyses.The solicitation is being provided by the City without any warranty or representation,express or implied,as to its content,its accuracy, or its completeness.No warranty or representation is made by the City or its agents that any Proposal conforming to these requirements will be selected for consideration,negotiation,or approval. The City shall have no obligation or liability with respect to this solicitation,the selection and the award process,or whether any award will be made.Any recipient of this solicitation who responds hereto fully acknowledges all the provisions of this Disclosure and Disclaimer,is totally relying on this Disclosure and Disclaimer,and agrees to be bound by the terms hereof.Any Proposals submitted to the City pursuant to this solicitation are submitted at the sole risk and responsibility of the party submitting such Proposal, This solicitation is made subject to correction of errors, omissions,or withdrawal from the market without notice.Information is for guidance only,and does not constitute all or any part of an agreement. The City and all Proposers will be bound only as, if and when a Proposal (or Proposals), as same may be modified, and the applicable definitive agreements pertaining thereto, are approved and executed by the parties, and then only pursuant to the terms of the definitive agreements executed among the parties.Any response to this solicitation may be accepted or rejected by the City for any reason,or for no reason,without any resultant liability to the City. The City is governed by the Government-in-the-Sunshine Law,and all Proposals and supporting documents shall be subject to disclosure as required by such law. All Proposals shall be submitted in sealed proposal form and shall remain confidential to the extent permitted by Florida Statutes, until the date and time selected for opening the responses. At that time, all documents received by the City shall become public records. Proposers are expected to make all disclosures and declarations as requested in this solicitation.By submission of a Proposal,the Proposer acknowledges and agrees that the City has the right to make any inquiry or investigation it deems appropriate to substantiate or supplement information contained in the Proposal,and authorizes the release to the City of any and all information sought in such inquiry or investigation. Each Proposer certifies that the information contained in the Proposal is true, accurate and complete, to the best of its knowledge, information,and belief, Notwithstanding the foregoing or anything contained in the solicitation,all Proposers agree that in the event of a final unappealable judgment by a court of competent jurisdiction which imposes on the City any liability arising out of this solicitation, or any response thereto, or any action or inaction by the City with respect thereto,such liability shall be limited to$10,000.00 as agreed-upon and liquidated damages.The previous sentence, however, shall not be construed to circumvent any of the other provisions of this Disclosure and Disclaimer which imposes no liability on the City. In the event of any differences in language between this Disclosure and Disclaimer and the balance of the solicitation, it is understood that the provisions of this Disclosure and Disclaimer shall always govern.The solicitation and any disputes arising from the solicitation shall be governed by and construed in accordance with the laws of the State of Florida. Il TB • • 22 PROPOSER CERTIFICATION I hereby certify that: I, as an authorized agent of the Proposer, am submitting the following information as my firm's proposal; Proposer agrees to complete and unconditional acceptance of the terms and conditions of this document, inclusive of this solicitation,all attachments, exhibits and appendices and the contents of any Addenda released hereto, and the Disclosure and Disclaimer Statement; Proposer agrees to be bound to any and all specifications, terms and conditions contained in the solicitation, and any released Addenda and understand that the following are requirements of this solicitation and failure to comply will result in disqualification of proposal submitted; Proposer has not divulged, discussed, or compared the proposal with other Proposers and has not colluded with any other Proposer or party to any other proposal; Proposer acknowledges that all information contained herein is part of the public domain as defined by the State of Florida Sunshine and Public Records Laws; all responses, data and information contained in this proposal, inclusive of the Proposal Certification,Questionnaire and Requirements Affidavit are true and accurate, Name of Proposer's Authorized Representative: Title of Proposer's Authorized Representative: se Haber Owner Signature of Proposer's Autho•ed RepresVtive: Date: December 8,2016 State of Re"6'x'1 On this.1 day of 4"4 7 20,22,personally appeared before me 7 who County of A/,au,)40/e) stated that (s)he is the 10 s: /'V ,e2. of fez e c/dP)/•-/ , a corporation, and that the instrument was signed in behalf of the said corporation by authority of its board of directors and acknowledged said instrument to be its voluntary act and deed. Before mu — — " — — — A — "�' — • �����!"'P�:,, CARIOAD HERNANDEZ 0 .:'` `- *�= Notary Public•Stale of Florida 1 • "p .•s My-Comm-�tree-Nov 9,2017 Notary Pu L`;�,�.; the Comm1 4c #FF 17058 1�y, ' .A ' Bond Throug National Notary Ms . My Commissio nom:- T / -41► ! — T 170 ) 23 APPENDIX C Minimum Requirements & Specifications ITB 2017-039-JC Plumbing Services PROCUREMENT DEPARTMENT 1755 Meridian Ave. 3rd Floor Miami Beach, Florida 33139 ITB 01 • 26 1. Minimum Eligibility Requirements. The Minimum Eligibility Requirements for this solicitation are listed below. Bidder shall submit, with its bid or upon request by the City, the required submittal(s) documenting compliance with each minimum requirement. Proposers that fail to include the required submittals with its bid or fail to comply with minimum requirements shall be deemed non-responsive and shall not have its bid considered. The stated minimum requirements shall be applicable during the duration of the contract. 1 RIA.MIANIMAINERIONNIVIIMENIVIKOMMicalLEMIN,M1 U1 1 1 ` ,.' BiNCen ub tt.,it its bid, ion rYKOS M,tF g r tri " t'fitO O:tlite 1i ns t 2. General Work Requirements. All work shall be performed in accordance with generally accepted industry principles, standards and practices, including (but not limited to the Uniform Plumbing Code and the South Florida Building Code. Prices offered by the successful bidder shall include (but not be limited to)all services, parts, labor, materials, equipment supervision, applicable taxes, employee expenses, profit and overhead as required to complete the work. The City may utilize any award resulting from this ITB to: 1) address or correct various routine plumbing requirements(on a time and materials basis, including parts, labor, materials, equipment and supervision, on an "as needed" basis, for emergency and non-emergency repairs; or 2) participate in a pool of prequalified plumbing contractors for planned repairs and projects. The services that may be acquired under the resulting contract include, but are not limited to, the following: 14 lllt att gpJif, if tt t i lnKIO I 2 liist1ll t r1) j `rnodif`p tion t torm dr dr dr i,. 3 Cte141ng and n'tol i of a ra entI r,n sanitary.' r l _ge 9s to a slindt ge sRtor,.a►t ' ICI b t h . llnit ll l' 1jj a... 11X11. ` t 1 fkb L. 'u ' 819111filitetli f.011114MICERIMENTSSOISTAIRTERIMMIONWISIVIMEM1 j (nst ll lon, o tilt o, xMfy kl[ohen11 I e,,:dishwa herr,ARM t.l lrtoh ll.ink 11t p tb t.i list Pati i°t ? R iEIMl ip. s t 11l�03MBI t r! ► �o� ± t. t `i d o tri � . a Ir!terc ptors, Psand it 1± t, _t it =0i" 13.1 ew 1 113 did, , t° ti a`tid # M.tk e4 tatfo s Ir ad titentittiERINKi tl? l to [ fid lEn fa�g df .t g 4th chars d dt1 1t t MO OM M ISI d tI :` . 14fyi."of Mla : e Ij tit ifig00111141121fitIntinteleMOIRIENIASNEMMINI RINIVI r Mt t of tt t)" f . [t ICOME ,VERN t pe t 1 re the felt OttESIMMib t` I aNDfiter ` MI1 ' .II1.d_::3:acKtl r vehte( MdflattelfillfinEM151gi t t e t .15(1 Iti j;D,°A It i b i ro eqt t� lrir t r e _ �_ �.._ �... t.�b t,..��... � .;�� 'e V�,... t `M0t1.0.d0414t4 is VSIMISSIMIES 27 Tasks shall not be construed to represent any amount which the City shall be obligated to purchase under the contract, or relieve the Bidder of his obligation to fill all orders placed by the City. No bid will be considered which stipulates that the City guarantees to order a specific quantity of any service, 211RiligithiteMIUMMUMNIAMECALMMICMin rK` r fic .regwr er yi>t :{y.NgitI Ir..t i u e y I tr t 100% of /f "'r l . l*ts n}Jy N r trr tlV „sl`n'lll i 1 4 �s tfi. t O to ne.mit .Costs fo §{�?.. p7ot1on Wilkft00111MOU 2.2 Parts and Supplies. It shall be the responsibility of the contractor to supply all necessary tools, equipment and transportation to perform the work as requested. If a contractor has to send a technician to a tool rental warehouse or a supply house to get material to finish a specific job for the City, and the contractor has 2 or more technicians working on this specific job, the contractor cannot charge the City for men waiting for the technician to return from the tool rental warehouse or the supply house. From time to time, the City reserves the right to provide supplies, materials or parts necessary for the work performed by the contractor. reg,jf? Iwo j i s.. . . p;01i �e��t'� �.1M���1����� �i:��i�,�.�. tp ��I r��l�l � X11 e���AICtf� g tltIWI r h 15 r 1e emu be .amt tc ' d w1_Il;;r tjI .relectlortOf I vetcej 3. Roadmap for Projects Awarded on a Time and Materials Basis. The City may award work on a time and materials basis in accordance with Section 0200, Sub-Section 14, Multiple Award. City departments may request Purchase Orders to be issued to the primary vendor for any group on a time and material basis (bid hourly charges plus discounted parts or materials) for a specific request or for a pre-need encumbrance (blanket order). Pursuant to Section 0200, General Condition 14, entitled Multiple Awards, secondary and primary vendors may also be considered. 3.1 Work Day. For billing purposes, tooremaraNIAMEMetingarain Mot da l thr `g Rau Calls outside these hours and days will be considered non-regular. 41§0,4>4I,M4; "t. x R p E g r r #r 11 be as f llo 2,1> g oyR ars/ ! o , S h l ? NEW t fti (2) : `s of;ver o Kiet(l.l if o do y t_ proRMon ra lea ,.Wark m I*VAIred 24. lou day, pays.aieeki.'.IRCATIO,M1 (6001141tRel 3S22,No name_cV,Wk• Work shall commence within 48 Mt o ,written (tot1fOati by the project/contract manager. 1 2 17-00 3.3 Administrative Mark-up for Parts. For parts and materials ordered under this option, vendors shall provide quotes or invoice, as determined by the Contract Manager,based on the cost of parts and materials plus the agreed to mark-up. In determining cost of materials to which the mark-up may be applied, the contracting officer may: i, require the vendor to provide actual cost of parts and materials(e.g., contractor's invoice, MSRP, etc.)prior to the issuance of a Purchase Order or approval of an invoice; or ii. may require the vendor to seek and document competition from its sources for the required parts or materials; or ii. may obtain any data are available from primary or other secondary sources and use that data in determining a fair and reasonable price. The cost of any ancillary third-party services that are provided by the vendor, with prior approval of the Contract Manager, may be determined in the manner prescribed above. 3.2. Estimates. The project/contract manager may require the contractor to provide an estimate prior to the commencement of work. Any actual charges that exceed estimate amounts must be pre-approved by the project/contract manager. 4. Roadmap for Projects Awarded Pursuant to Pool of Prequalified Contractors. In lieu of a time and materials order, the project/contract manager may request quotes from contractors authorized to participate in the Pre-Qualified Bidder Pool for larger repair projects or other planned projects. Responsive, responsible bidders (awarded or not) are eligible to participate in the Pre- Qualified Bidder Pool, at the discretion of the bidder and as indicated on the Cost Proposal Form at the time of submission. At its own expense, the contractor shall visit the site and prepare a detailed hourly rate bid, based on the contractor's contract rates for accomplishing the work. Each bid prepared by the contractor shall include an acceptable description of the nature, extent and character of the work required, as well as performance and delivery schedules. In this case, projects may be awarded on a Lump Sum or Time and Material basis as determined by the project/contract manager. .`F.o 4 o stI to I o$. O,O` MDIA co trA t r i .01 [Ck1','lC'0001.0-;Co*I'M pittViii fl'WA npi 4 1lu1('d, & 7 lt(o. lox 3r<I ognmid 4EOri` wl a tir tO itCO ee 1l(i $ 0,000,MPIO t/ ra t.r`iianage: gY o)110(11 tom. 4 t s pr t 8 uingfit1:011 C2PIEVI 'ojects Itn rthis c teg gAVVIATIORMINAI 4.3 In determining the lowest and best contractor for the project, in addition to price, there shall be considered the following: (1)The ability, capacity and skill of the bidder to perform the contract, (2)Whether the bidder can perform the contract within the time specified, without delay or interference. (3) The character, integrity, reputation,judgment, experience and efficiency of the bidder. (4)The quality of performance of previous contracts. (5) The previous and existing compliance by the bidder with laws and ordinances relating to the contract. The City Manager's approval is required when the contractor offering the lowest cost is not selected. 29 CEEIIFMANPIIANIIIQIRRAYWNTMIQNNROIKOWOIIAIIGOMIOAIM MEM kfMtEth*NVCEMttafgWikl)KgntGfCVMKttaggttMVNM Refer to Section 0200, Instructions to Bidders, 24. Bid Bonds, Performance Bonds, and Certificates of Insurance. Within seven (7) calendar days of notification by the City, Contractor shall furnish a Performance Bond from an A-rated Financial Class V Surety Company. If the vendor fails to deliver - the bond within this specified time the City shall declare the vendor in default of the contractual terms and conditions, and the City shall not accept any offer from that vendor for a twelve (12) month period following such default. The following specifications shall apply to any bond provided: A. All bonds shall be written through surety insurers authorized to do business in the State of Florida as surety, with the following qualifications as to management and financial strength according to the latest edition of Best's Insurance Guide, published by A.M. Best Company, Oldwick, New Jersey: Bond Amount Best Rating 500,001 to 1,500,000 B V 1,500,001 to 2,500,000 A VI 2,500,001 to 5,000,000 A VII 5,000,001 to 10,000,000 A VIII Over 10,000,000 A IX B. On contract amounts of $500,000 or less, the bond provisions of Section 287.0935, Florida Statutes (1985) shall be in effect and surety companies not otherwise qualifying with this paragraph may optionally qualify by: 1. Providing evidence that the surety has twice the minimum surplus and capital required by the Florida Insurance Code at the time the solicitation is issued; 2. Certifying that the surety is otherwise in compliance with the Florida Insurance Code; and 3. Providing a copy of the currently valid Certificate of Authority issued by the United States Department of the Treasury under SS, 31 USC 9304-9308. Surety insurers shall be listed in the latest Circular 570 of the U.S. Department of the Treasury entitled "Surety Companies Acceptable on Federal Bonds", published annually. The bond amount shall not exceed the underwriting limitations as shown in this circular. C. For contracts in excess of 500,000 the provisions of Section B will be adhered to plus the company must have been listed for at least three consecutive years, or holding a valid Certificate of Authority of at least 1.5 million dollars and on the Treasury List, D. Surety Bonds guaranteed through U.S. Government Small Business Administration or Contractors Training and Development Inc. will also be acceptable. 2 7-0 J 30 E. In lieu of a bond, an irrevocable letter of credit or a cash bond in the form of a certified cashier's check made out to the City of Miami Beach, Florida, will be acceptable. All interest will accrue to the City during the life of this contract and/or as long as the funds are being held by the City. F. Bond(s)shall be recorded in the public records of Miami-Dade County and provide City with evidence of such recording. It shall be the responsibility of all awarded vendors to be regularly informed to conform to any changes in standards issued by any regulatory agencies that govern the commodities or services applicable to this solicitation during the term of the contract. { 31 APPENDIX D 03:1 Special Conditions ITB 2017-039-JC Plumbing Services PROCUREMENT DEPARTMENT 1755 Meridian Ave. 3rd Floor Miami Beach, Florida 33139 1171 *- 32 1. TA I QF Wf C . f:tO fi l 11 Te Mt aO` e fn IM( )Y.r t f uOWet ;,fl OA tr O [1140 -„ ➢ t yor MOlty ! J. The City of Miami Beach has the option to WM the contract at the sole discretion of the City Manager for altit(lq(t x(2), ,(1) yitr 011.01 b r kffrito 7 ar 5a is Renewal of the contract is a City of Miami Beach prerogative, not a right of the Contractor. Such option will be exercised, if at all, only when it is in the best interest of the City of Miami Beach. In the event that the contract is held over beyond the term herein provided it shall only be from a month-to-month basis only and shall not constitute an implied renewal of the contract. Said month to month extension shall be upon the same terms of the contract and at the compensation and payment provided herein, and shall not exceed six(6) months. 2. I , LQ W MI#s! 1V PINRt IRZIKI RIVK l It' Ac 1 I IEf th. , itIMC MI t i>g. 1 e if l Zil t ( j((3):: Stet, f,tliltiM o td d;`;f to EI 2.1 OPTION TO RENEW WITH PRICE ADJUSTMENT: The contract could be extended for an additional two (2), one (1) year terms, on a year to year basis, at the sole discretion of the City Manager. Prior to completion of each exercised contract term, the City may consider an adjustment to price based on Consumer Price Index increase. Change shall not be more than the percentage increase or decrease in the Consumer Price Index CPI-U (all urban areas) computed 60 days prior to the anniversary date of the contract It is the vendor's responsibility to request any pricing adjustment under this provision. For any adjustment to commence on the first day of any exercised option period, the vendor's request for adjustment should be submitted 60 days prior to expiration of the then current contract term. The vendor adjustment request must clearly substantiate the requested increase. If no adjustment request is received from the vendor, the City will assume that the vendor has agreed that the optional term may be exercised without pricing adjustment. Any adjustment request received after the commencement of a new option period may not be considered. 3. ME ,. . v I=I YM.ENTI movinentetlotoottittamtoompugool timo w itai s.I; g n. I.i1?..rea l I l i► :tttieir t t I,.tf.1 'Q .f o :M C o C:i. tl `m .- Il f ti„ rte rtrt t t r O I Ifiz .i MMMT ?1;MIi'i$l 4. SHIPPING TERMS: Prices shall include freight to City's premises, and shall be F.O.B. Destination. The successful bidder shall hold title to the goods until such time as they are delivered, installed and accepted by an authorized City representative. 5. DELIVERY REQUIREMENTS: The successful bidders shall enclose a complete packing slip or delivery ticket with any items to be delivered in conjunction with this bid solicitation. The packing slip shall be attached to the shipping carton(s) which contain the items and shall be made available to the City's authorized representative during delivery, The packing slip or delivery ticket shall include, at a minimum, the following information: purchase order number; date of order; and a complete listing of items being delivered. 6. BACK ORDER ALLOWANCES: If the vendor cannot deliver an ordered item in accordance with the scheduled delivery date due to a current existing backorder of that item with the vendor's manufacturer or distributor; the vendor shall insure that such back orders are filled within 21 calendar days from the initial scheduled delivery date for the item. The vendor shall not invoice the City for back ordered items until such back orders are delivered and accepted by the City's authorized representative. It is understood and agreed that the City may, at its discretion, verbally cancel back orders after the grace period identified in this paragraph has lapsed, seek the items from another vendor, and charge the incumbent vendor under this contract for any directly associated re-procurement costs. If the vendor fails to honor these re-procurement costs, the City may terminate the contract for default. 7 lARIM, ARAN `BE RIMkit trER f'!` ! M r[, M I O d r' i g_rl iSM t COM err I '� �� ?1 ; d, + fJ INOMMORMIUMPTORMIMENtatei For new installations, contractor shall additionally provide full manufacturer warranty to the City. In addition to all other warranties that may be supplied by the bidder, the bidder shall warrant its products and/or service against faulty labor and/or defective material for a minimum period of one (1) year after the date of acceptance of the labor, materials and/or equipment by the City. This warranty requirement shall remain in force for the full one (1) year period; regardless of whether the contractor is under contract with the City at the time of the defect. Any payment by the City on behalf of the goods or services received from the contractor does not constitute a waiver of these warrant provisions. The contractor shall be responsible for promptly correcting any deficiency, at no cost to the City, within five (5)calendar days after the City notifies the contractor of such deficiency in writing. If the contractor fails to honor the warranty and/or fails to correct or replace the defective work or items within the period specified, the City may, at its discretion, notify the contractor, in writing, that the bidder may be debarred as a City bidder/proposer and/or subject to contractual default if the correction or replacements are not completed to the satisfaction of the City within ten (10)calendar days of receipt of the notice. If the contractor fails to satisfy the warranty within the period specified in the notice, the City may(a) place the contractor in default of the contract, and/or(b) procure the products or services from another contractor and charge the contractor for any additional costs that are incurred by the City for this work or items, either through a credit memorandum or through invoicing. 8. BACKGROUND CHECKS: The contractor shall conduct a full criminal background check at its own expense on each of its employees engaged in providing services under this ITB or any resulting Agreement prior to the commencement of said services. No contractor employee shall be eligible to perform services, pursuant to this ITB or resulting Agreement, if he or she: (1) has been convicted of or was placed in a pre-trial diversion program for any crime involving dishonesty or 1.6"1.1I i3 1 34 breach of trust; embezzlement; drug trafficking; forgery; burglary; robbery; theft; perjury; possession of stolen property; identity theft; fraud; money laundering; shoplifting; larceny; falsification of documents and/or (2) has been convicted of any sex, weapons, or violent crime including but not limited to homicide; attempted homicide; rape; child molestation; extortion; terrorism or terrorist threats; kidnapping; assault; battery; and illegal weapon possession, sale or use. The contractor shall defend, indemnify and hold the City, its officers, employees, and agents harmless from and against any and all liability, loss, expense (including reasonable attorneys'fees) or claims for injury or damages arising out of its failure to comply with this requirement. 35 { APPENDIX E Cost Proposal Form ITB 2017-039-JC Plumbing Services PROCUREMENT DEPARTMENT 1755 Meridian Ave. 3rd Floor 1 Miami Beach, Florida 33139 e -. .&1 36 APPENDIX E COST PROPOSAL FORM Failure to submit Cost Proposal Form in its entirety and fully executed by the deadline established for the receipt of proposals will result in proposal being deemed non-responsive and bein• rejected. Bidder affirms that the prices stated on the cost proposal form below represents the entire cost of the items in full accordance with the requirements of this ITB, inclusive of its terms, conditions, specifications and other requirements stated herein, and that no claim will be made on account of any increase in wage scales, material prices, delivery delays, taxes, insurance, cost indexes or any other unless a cost escalation provision is allowed herein and has been exercised by the City Manager in advance. The cost proposal form shall be completed mechanically or, if manually, in ink. Cost proposal forms completed in pencil shall be deemed non-responsive.All corrections on the cost proposal form shall be initialed. GROUP TIME AND MATERIAL BASIS Total Item Description Quantity U I M Unit Cost (Quantity_X_Unit_Cost) EQUIPMENT,PARTS AND SERVICE Hourly Al Hourl Rate—Re•ular 1600 Rate $ 65 $104,000 11 Hourly A2 Hourl Rate—Non Re.ular 400 Rate $ 97.50 $39,000 SUB-TOTAL—LABOR $143,000 Estimated Annual %Mark—up Net Cost Gross Costs(Dealer (See Appendix (Dealer Invoice Item Description Invoice Cost) Section 3.1) Cost,_X_%Mark-up) Administrative Mark-up for Parts and A3 Su.•lies $50,000 17 % $ 8,500.00 SUB-TOTAL—PARTS&EQUIPMENT $ 58,500.00 GRAND TOTAL(ITEMS Al-A3) $ 58,500.00 GROUP 2 POOL OF PREQUALIFIED CONTRACTORS Does bidder wish to be considered for Pool of Prequalified Contractors (See Appendix C, Section 4)? Note:Bidder shall be deemed responsive and responsible poor to be allowed to participate In Pool of X Pre•ualifled Contractors, Yes No Bidder's Affirmation Company: Haber &Son's Plumbing,Inc. Authorized Representative: Jose Haber Address: 4106 NW 37TH Avenue Telephone: 305-461-8653 Email: Haberandplumbing@bellsouth.net Authorized Representative's Signature: del 61-11177677-711'0 37 APPENDIX F Insurance Requirements ITB 2017-039-JC Plumbing Services PROCUREMENT DEPARTMENT 1755 Meridian Ave. 3rd Floor Miami Beach, Florida 33139 • -• 38 eri INSURANCE REQUIREMENTS This document sets forth the minimum levels of insurance that the contractor is required to maintain throughout the term of the contract and any renewal periods. XXX 1. Workers' Compensation and Employer's Liability per the Statutory limits of the state of Florida. XXX 2. Comprehensive General Liability (occurrence form), limits of liability $ 1,000,000.00 per occurrence for bodily injury property damage to include Premises/ Operations; Products, Completed Operations and Contractual Liability. Contractual Liability and Contractual Indemnity (Hold harmless endorsement exactly as written in"insurance requirements"of specifications). XXX 3. Automobile Liability-$1,000,000 each occurrence-owned/non-owned/hired automobiles included. 4. Excess Liability-$ .00 per occurrence to follow the primary coverages. XXX 5, The City must be named as and additional insured on the liability policies; and it must be stated on the certificate. 6. Other Insurance as indicated: Builders Risk completed value $ .00 Liquor Liability $ .00 Fire Legal Liability $ .00 Protection and Indemnity $ .00 Employee Dishonesty Bond $ .00 Other $ .00 XXX 7. Thirty (30)days written cancellation notice required. XXX 8. Best's guide rating B+:VI or better, latest edition. XXX 9. The certificate must state the proposal number and title The City of Miami Beach is self-insured. Any and all claim payments made from self-insurance are subject to the limits and provisions of Florida Statute 768.28, the Florida Constitution, and any other applicable Statutes. B 17 39MNI O Addendum No.2 to ITS 15-13256-JE ATTACHMENT "B - (1)" -VENDOR EXPERIENCE Submit one form for each reference (MUST BE SUBMITTED WITH YOUR BID SUBMITTAL) Prime Vendor/Sub Vendor: Haber& Son's Plumbing, Inc. Client Name: Jackson Memorial Mental Health Client Address: 2 S. Federal Highway, Dania Beach, FL 33004 Client Contact Name& Location: F.H. Paschen Title: Project Manager Phone: 305-940-0264 Fax 305-940-0265 E Mall: jbowden@FHPaschen.com Brief Description of the Work:(This project shall meet Section 5—Minimum Qualifications of Bidder; Para.5.01 of this ITS). ET 1 Admitting modernization - East Tower 1st Floor Sanitary Drain and vents Cast Iron Pipe, Domestic Hot & Cold Water Copper Pipe Type M & L, Plumbing Fixtures, Plumbing Demolition, Plumbing Permits. Project No. 53013104 (04/13/13) Work Began: January 16,2014 Work Completed:April 11,2014 Explain Extenuating Circumstances with Schedule(use additional sheets as necessary): Was it on time? Yes Was it on budget? Yes Was the Client a Health Care Facility/Hospital? Yes 1f No in If"yes"—Number of Beds Serviced: Vendor Project Manager Name/Title: Alana Sullivan Additional information(attach additional pages as necessary): Describe any additional services provided; provide total value of the contract, result of the project and vendors role in the project, difficulties experienced during implementation or ongoing operations. If contract was terminated,state the reason for termination. P lease indicate If this project was AHCA Reviewable: Yes I No ❑ Please indicate If ICRA measures were applied: Yes No ❑ Class Page 12 of 14/John Ellis III/Addendum No 2. ITB 15-13256-JE Addendum No.2 to ITB 15-13256-JE ATTACHMENT "B - (1)" -VENDOR EXPERIENCE Submit one form for each reference (MUST BE SUBMITTED WITH YOUR BID SUBMITTAL) Prime Vendor/Sub Vendor: Haber& Sons Plumbing, Inc. Client Name: Jackson Memorial Hospital Client Address: 20356 Northeast 16th Place Client Contact Name& Location: Citywork Construction LLC. Title: Project Manager Phone: 305-249-5885 Fax 305-249-5886 E Mail: jbowden@FHPaschen.com Brief Description of the Work:(This project shall meet Section 5—Minimum Qualifications of Bidder; Para.5.01 of this ITB).Jackson Memorial Hospital West Wing 15th Floor Interior Renovation Demolition, Sanitary Waste and vents Cast-Iron Pipe Domestic Cold and Hot Water, Copper Pipe , Plumbing Fixtures, Medical Gas Cert, Medical Work, Plumbing Permits. Work Began: January 16,2014 Work Completed:April 11,2014 Explain Extenuating Circumstances with Schedule(use additional sheets as necessary): Was it on time? Yes Was it on budget? Yes Was the Client a Health Care Facility/Hospital? Yes No ❑ if"yes"—Number of Beds Serviced: Vendor Project Manager Name/Title: Arnaldo Rodriguez Additional Information(attach additional pages as necessary): Describe any additional services provided; provide total value of the contract, result of the project and vendors role in the project, difficulties experienced during implementation or ongoing operations. If contract was terminated,state the reason for termination. Please Indicate if this project was AHCA Reviewable: Yes.f No ❑ Please indicate if ICRA measures were applied: Yes No ❑ Class Page 12 of 14/John Ellis III/Addendum No 2.ITB 15-13256-JE Addendum No.2 to ITS 15-13256-JE ATTACHMENT "B - (1)" -VENDOR EXPERIENCE Submit one form for each reference (MUST BE SUBMITTED WITH YOUR BID SUBMITTAL) Prime Vendor/Sub Vendor: Haber& Son's Plumbing, Inc. Client Name: Jackson Memorial Hospital Client Address: 1131 Southwest 4th Avenue Client Contact Name& Location: Lego Construction Company Title: President Phone: 305-381-8421 Fax 305-857-9916 E Mali: jdearmas@legocc.com Brief Description of the Work:(This project shall meet Section 5—Minimum Qualifications of Bidder; Para.5.01 of this ITB). Jackson Memorial Hospital East Tower Seventh Floor Sanitary Drain and vents Cast Iron Pipe, Domestic Hot& Cold Water Copper Pipe Type L, Plumbing Fixtures, Plumbing Demolition, Plumbing Permits. Work Began: May 30,2014 Work Completed:August 26,2014 Explain Extenuating Circumstances with Schedule(use additional sheets as necessary): Was It on time? Yes Was it on budget? Yes Was the Client a Health Care Facility/Hospital? Yes 1 No in If"yes"—Number of Beds Serviced: Vendor Project Manager Name/Title: Arnaldo Rodriguez Additional Information(attach additional pages as necessary): Describe any additional services provided; provide total value of the contract, result of the project and vendors role in the project, difficulties experienced during Implementation or ongoing operations. If contract was terminated,state the reason for termination. Please indicate if this project was AHCA Reviewable: Yes I No ❑ Please indicate if ICRA measures were applied: Yes 1/ No 0 Class Page 12 of 14/John Ellis III/Addendum No 2. ITB 15-13256-JE 011920 Local Business Tax Receipt Miami-Dade County, State of Florida -THIS IS NOTA BILL-DO NOT PAY ILB air 6761770 BUSINESS NAME/LOCATION RECEIPT NO. EXPIRES HABER&SONS PLUMBING INC RENEWAL SEPTEMBER 308 2017 4106 6 NW 1 AVE 7035173 HIALEAHMust be displayed at place of business FL 33142 Pursuant to County Code Chapter 8A-Art.9&10' OWNER SEC.TYPE OP BUSINESS HABER&SONS PLUMBING INC 196 GENERAL BUILDING CONTRACTOR PAYMENT RECEIVED CGC1609075 BY TAX COLLECTOR 1Norker(s) 1 $45.00 07/13/2016 CHECK21-16-084867 This Local Business Tax Roulet only confirms payment of the Looal:Business Tau The Receipt Is not s license, permit,or a certification of the solders squalificatione,to do business.Holder must comply with any governmental or nongovernmental regulatory laws and requirements which apply to the business. The RECEIPT NO.above must be displayed on all commercial vehicles-Marl-Dada Code Sec 8a-276. For more information,visit www.miemidada.eav/taxcollpctor 003890 Local Business Tax Receipt Miami-Dade County, State of#lorida -THIS IS NOT A BILL-DO NOT PAY 3991362 BUSINESS NAMS/LOCATION RECEIPT NO. EXPIRES HABER&SONS PLUMBING INC RENEWAL SEPTEMBER 30, 2017 4106 NW 37 AVE 416561 E Must be displayed at place of business HIALEAH FL 33142 Pursuant to County Code Chapter 8A-Art 9&10 OWNER SEC.TYPE OP BUSINESS PAYMENT RECEIVED HABER&SONS PLUMBING INC 196 PLUMBING CONTRACTOR BY TAX COLLECTOR CFC057165 $45.00 07/13/2016 Workers) 1 CHECK21-16-084871 This Local Business Tax Receipt only confirms payment of the Local Business Tex.The Receipt is nota license, permit,era certification of holders qquallfloationa,to do business.Holder must comply with any governmental or nongovernmental regulatory laws and requirements whioh apply to the business. The RECEIPT NO.above must be displayed on all commercial vehicles-Miami-Dade Code Sec 8a-278. For more information,visit teww.miomidade,govitaxoallectot Installers Name: Jose Haber MEDICAL GAS CERTIFICATION otNPPA 88 2012 LDITION-ASSE Series 6010. Installer ASME Boiler and Pressure Code Section IX CILB Course#0001281. Bearer of ` ' this card complies with the NPPA renewal . , requirements and has brazed within a 6 •r month period. 1111 II III EXPIRES: 1/31/2017 Its# 03-0125-04 CERTIFIED BY: UNITED SERVICE TRAINING CORP i _ ......._..._...-n.•3rr- -.vw-,•�•c>e v-crcrr.,rc_.....__._..._.._. __----_ _"_..._�....,_.._....._ ., _._. �..-.._...,.._ fS ZI'O.:.G'3'IVV Vt'V�"'w"ICGT rAl"C"Y...`. STATE OF FLORIDA DEPARTMENT OF BUSINESS AND PROFESSIONAL REGULATION if CONSTRUCTION INDUSTRY LICENSING BOARD ,� LICENSE NUMBER ! d *- CFC057185 i � The PLUMBING CONTRACTOR Named below IS CERTIFIED `m f, ...- Expiration the provisions of Chapter 489 FS. Expiration date: AUG 31, 2018 ';144.;�..,�: ISI HABER, HABER&JOSE ONS PLUMBING INC p "I '`Y 5171 S W 5TH TERRACE �. ' "r MIAMI FL 33134 „r.. I'a�'!�. 'PJ • IQ. ..Lt.....h ISSUED: 07/11/2018 DISPLAY AS REQUIRED BY LAW SEQ# L1807110000841 -.._..._..-Y'r't4FPC"6iw,..t"'CJt.I'U`t.'mwY'C'"....""..--....«---............"._.«_.�,..... ., ""-'^'-"_....._......,...-. ---.......Yttral: WW-V1,-Zetr ftT7'Crct- STATE OF FLORIDA DEPARTMENT OF BUSINESS AND PROFESSIONAL REGULATION CONSTRUCTION INDUSTRY LICENSING BOARD 4 :,, '�..,..�.�.._-" ....0.6.4.1121=11=111 .B11121=11=111 . �_ �: �: C0C1509076 1. r The GENERAL CONTRACTOR ^ k ,, �," Named below IS CERTIFIED .Ya,. Under the provisions of Chapter 489 FS. Expiration date: AUG 31, 2018 • • HABER, JOSEI ,�,� ,. . HABER&SONS PLUMBING INC •r * �" 1'' 4108 NW 37TH AVE . ` 5171 SW 5TH STREET •''' ,L.4. 1.,'' MIAMI FL 33134 • a'I. ISSUED: 07/11/2016 DISPLAY AS REQUIRED BY LAW SEQ# L1807110000725 I I Internal Services Department MMS Small Business Development t,19th Floor COUNTY 111 NW Miami,Florida 3 128 miamldade,aov T 305-375-3111 F 305-315-3163 April 14,2016 CERT NO: 4779 Approval Date: 4/14/2016 - SBE/CONS LEVEL 1 Mr.Jose Haber Expiration Date: 2/28/2018 HABER&SONS PLUMBING,INC. 4106 NW 37th Ave Miami, FL 33142-0000 Anniversary Date: April 14,2017 Dear Mr. Haber: Miami-Dade County Small Business Development(SBD),a division of Internal Services Department(ISD),is pleased to notify you of your firm's continuing eligibility as a certified Small Business Enterprise Construction Services(SBE/CONS)in accordance with section 10-33.02 of the Code of Miami-Dade County. Your firm is certified in the categories listed below. The SBE/CONS certification is continuing through the Anniversary Date listed above,contingent upon your firm maintaining its eligibility based on the criteria outlined in the aforementioned code.You will be notified of your annual responsibilities in advance of the Anniversary Date.You must submit the annual AFFIDAVIT FOR CONTINUING ELIGIBILITY no later than the Anniversary Date to maintain your eligibility.Your firm will be listed in the directory for all certified firms,which can be accessed through Miami-Dade County's SBD website: http://www,n)iamidade.govlbysiness/business-certification-programs.asp. If there is a material change in your firm,you must advise this office by submitting a status change form with the associated supporting documentation,within thirty(30)days. Changes may include,but are not limited to, ownership,officers,directors,management,key personnel,scope of work performed,daily operations,on-going business relationships with other firms or individuals or the physical location of your firm. After our review,you will receive instructions as to how you should proceed,if necessary. Failure to do so will be deemed a failure on your part to cooperate and will result In action to remove your firm's certification. If you have arty questions or concerns,you may contact our office at 305-375-3111. Sincerely, � hompson,;'Sectiion Chief Small Business Development Division CATEGORIES:(Your firm may bid or paepeipate on contracts only under these categories) 238115-NEW SINGLE.FAMILY HOUSING CONSTRUCTION(EXCEPT OPERATIVE BUILDERS)(SBEICONS) 236110.NEW MULTIFAMILY HOUSING CONSTRUCTION(EXCEPT OPERATIVE BUILDERS)(see/CONS) 23811T•NEW HOUSING OPERATIVE BUILDERS(SBE/CONS) 235118-RESIDENTIAL REMODELERS(98E/CONS) 236210-INDUSTRIAL BUILDING CONSTRUCTION(SBE/CONS) 238220-COMMERCIAL AND INSTITUTIONAL SUILDING CONSTRUCTION(SBEICONS) 237110-WATER AND SEWER LINE AND RELATED STRUCTURES CONSTRUCTION(SBE/CONS) 238110•POURED CONCRETE FOUNDATION AND STRUCTURE CONTRACTORS(SSE/CONS) 238120-STRUCTURAL STEEL AND PRECAST CONCRETE CONTRACTORS(SBEICONS) 238220-PLUMBING,HEATING,AND AIR-CONDiTIONIN0 CONTRACTORS(SBEICONS) 238510-SITE PREPARATION CONTRACTORS(SBE/CONS) Internal Services Department MIAMI Small Business Development COUNTY111 NW 1 Street,19th Floor Mtami,Florida 33125 miamIdado.gov T 305375-3111 F 305-375-3160 April 14,2016 CERT NO: 7642 Approval Date: 4/14/2016 - DBE Mr.Jose Haber HABER&SONS PLUMBING,INC. 4106 NW 37th Ave Miami,PL 33142-0000 Anniversary Date:Annually on April 14 Dear Mr.Haber: Miami-Dade County Small Business Development(SBD),a division of the Internal Services Department(ISD),is pleased to notify you that your firm is certified under the Florida Unified Certification Program(UCP).Your firm meets the eligibility requirements for certification as a Disadvantaged Business Enterprise(DBE)in accordance with 49 CFR Part 26. DBE certification Is continuous with no expiration date;however,firms are required to attest that there are no changes via the No Change Declaration form annually on the firm's anniversary date to remain certified.You will be notified of your annual responsibilities in advance of the Anniversary Date listed above.You must submit the annual No Change Declaration form no later than the Anniversary Date to maintain your eligibility.Your firm will be listed in the UCP DBE Directory which can be accessed through the Florida Department of Transportation's website: r 1.• . .. = 3 - _• ; •,..•its e i r _ .1 -a :-- I DBE certification Is NOT a guarantee of work,but it enables the firm to compete for and perform contract work on all USDOT Federal Aid(FAA,PTA and FHWA)projects in Florida as a DBE contractor,sub-contractor, consultant,sub-consultant or material supplier. If at any time there is a material change in your firm,you must advise this office by sworn affidavit and supporting documentation within thirty(30)days.Changes Include,but are not limited to ownership,officers,directors, management,key personnel,scope of work performed,daily operations,on-going business relationships with other firms, individuals or the physical location of your firm.After our review,you will receive instructions as to how you should proceed,if necessary. Failure to comply will result in action to remove your firm's DBE certification. Questions or concerns should be directed to this office by mail or telephone.Our telephone number is(305)375- 3111 and fax number is(305)375-3160. Sincerer Ctac us Thompson,Section Chief Small Business Development Division Internal Services Department MBAMII-DE Small Business Development 'CQUNTY 111 NW 1 Street, 19th Floor Miami, Florida 33128 rrr6amidade.gov T 305-375-3111 F 305-375-3160 `` — • CERT. NO: 10956 Approval Date: 02/20/2015-MICRO/SBE February 24, 2015 Expiration Date: 02/28/2018 Mr. Jose Haber HABER& SONS PLUMBING, INC. 4106 NW 37th Ave Miami, FL 33142-0000 Dear Mr. Haber: Miami Dade County Small Business Development (SBD), a division of the Internal Services Department (ISD)has completed the review of your application and attachments submitted for certification. Your firm is officially certified as a Miami Dade County Micro/Small Business Enterprise (MICRO/SBE) in accordance with section 2-8.1.1.1.1 of the code of Miami Dade County. This MICRO/SBE certification is valid for three years provided that you submit a "Continuing Eligibility Affidavit" on or before your anniversary date of February 20 for the first and second year of the three year period. The affidavit must indicate any changes or no changes in your firm pertinent to your certification eligibility. The submittal of a"Continuing Eligibility Affidavit"annually with specific supporting documents on or before your Anniversary Date is required to maintain the three year certification. You will be notified of this responsibility in advance of the Anniversary Date. Failure to comply with the said responsibilities may result in immediate action to decertify the firm. Pursuant to the applicable section of the code as listed above, "once your firm has been decertified, your firm shall not be eligible to re-apply for certification for twelve(12)months from the time of the decertification." If, at any time, there is a material change in the firm, including, but not limited to, ownership, officers, director, scope of work being performed, daily operations, affiliation(s)with other businesses or the physical location of the firm, you must notify this office, in writing, within (30) days. Notification should include supporting documentation. You will receive timely instructions from this office as to how you should proceed, if necessary. This letter will be the only approval notification issued for the duration of your firm's three years certification. If the firm attains graduation or becomes ineligible during the three year certification period you will be property notified following an administrative process that your firm's certification has been removed pursuant to the code. Your company is certified in the categories as listed below affording you the opportunity to bid and participate on contracts with goals. Please note that the categories listed are very general and are used only to assist our customers In searching the directory for certified firms to meet contract goals. You can find the firm's up-to-date certification profile as well as all other certified firms on the Miami Dade County Internal Services Department, Small Business Development Certified Firms' Directory at the website http://wuwu.miamidade.goI/business/business-certification-programs.asp. Thank you for doing business with Miami Dade County. Sincerely, Gary Hartfield, Division Director Small Business Development vision CATEGORIES: (Your firm may bid or participate on contracts only under these categories) INSPECTION SERVICES,CONSTRUCTION T „ 'TYPE(MICRO/SBE)" • - A '1 COST ESTIMATING(MICRO/SBE) CONSTRUCTION CONSULTING(MICRO/SBE) - PLUMBING MAINTENANCE AND REPAIR(INCLUDES TOILETS,ETC.)(MICROISBE) sbcr.Experian.com -735848552 -Haber& Sons Plumbing, Inc Page 1 of 4 a* -1"ti; r ian- Report Horne My reports My aceount Products Heli Business services Logout :fens. Ka-hair,resang l4 COn.potter, Search inquiry:licher&Sons Pr/ino ins,Minos;FL//My ProtilePlus"Report .ss of 15/4.4..0 f L5 ET Habor&Sons Plumbing,Inc Address: 4105 NW to Avo Key Personnel: President Joie Haber Mfarni FL ::e.3I42-4n22 SIC Code: 171 I fPiambing Heating&Are cersreeto-s (Maori Skims 1542-Nonrosklantag Conaroofien No Phone: 305,461•8663 021-Construction Single:family House:, Website: iatryfehatterfant coin NAIC53 Code: 2::52a).Piumb4ng Heating And Air- Cent:MS:11N Csnsoctots Exporter,DIN: 230220 Commensal And fosek.,or:34 Bordtosi Construeson Agent: Winer Joss natIO-R:?strIentsi Constuists.:r Agent Address: 5?71/9w 5T1 I TftirOCE) Business Type: Co:poratica Moos Ft. Experian File Established: December P.,94 Eat:tartan Years on File: 2 YOrIrr; Ferntly Linkage: Years 41 Rosiness: Move than 22 vows Pa:sm Haf:tis S Sons Plumbing trio 4104 NW 3f'th Are Total Employees: 5 wont.L Sales. sr89•90C, Bran:::es Asrnairva Claire 3.Sons Plumbic 9 Ira Filing Oats Provided by: 1.,,cat.or 4 .3r;NW 37th A.te Warn, R. UndiA Slateu Oats of Incorporation: ,x.r.,!0•1948 . • Current Days Beyond Terms(DST): Pay/hent Tradelines ./0 BCC Filings(sea Infts..:face sea,:isy Predicted DST tar 12/14/2015: Average Industry DST: 5 14 Businesses Scoring Worse: 41% Payment Trend Indicator: Stowe Bankruptcies* Lowest Month Balancn: 449 Highest S Month Balance: $.19 896 s`Liens 0 Current Total Account Balance: Judgments Filed Highest Credit Amount Extended: */Collections 0 Economic Diversity Back`af top • it a riLncrt,owned bush/est; •Into.5::1 disadvantaged business. Tier is a smell 1/oh/ole arirrerastraor.IBA/1/oto/9/rise ft,.is an SUA f.“,,program putn•Apant Government Activity Rack IS top il-it FPI(LOWING INFORM/010N IS PROVIDE!)ilY THF ritFRAL GOVER'Nftft ENT AND CIFICA SOLI RI/ES Congressional District 27 Central Contractor Registration YES Excluded front Federal Program(s) N/A Credit Summary Back to top Credit Ranking score:42a The objective of the Credit Ranking Score Is to predict payment behavior. High ltisk means that there is a significant probability of delinquent ft payMent,Low Risk ftleallS that there is a good probability of omtime High Low pcyrnelt t. Risk * Fish sbcr.Experian.com- 735848552- Haber& Sons Plumbing,Inc Page 2 of 4 Key Scorn Factors: •Writhe-of{10od commercial accounts'. •Percent of seriously delinquent commercial accounts. •Average b alano3 of recently delinquent communal accounts •Percent of flanfluent COtllnleroni aiccount5 Recommended Action:Ms ium Risk • •I • n r I n r.-_nnronncclo 1AnCPrr1 1N1411114 sber.Experian.com- 735848552 -Haber& Sons Plumbing, Inc Page 3 of 4 Back to Pup Payment Summary Moittf Payment Trends : Quarterly PaYmQnt Tren s ' -0-Industry .0°This Company 10090 8^ 400°t 80%u—* i i . 095 ♦� 8 60°h 60%° 40% ' 40% 20 20% 9L 0% 009116 12!16 03/16 08!18 09115 0611 6 06116 0711 6 08118 0911 8 1 011 8 'Percentage of on-lime payments by month 'Percentage of on-fine payments by quafter. Monthly Payment Trends•Recent Activity Quarterly Payment Trends-Recent Activity Date Current Up to 30 DOT 31-60 DOT 01.90 DOT >90 DOT Date Current Up to 30 D81 31-60 DOT 61.90 081 >90 DOT 06116 965h 2% 0% 0% 09/15 66% 18% 16% 0% 0% 0% 0% 0% 0% 06!11; 96% 2':0 0% 0% 0% 12/15100% e 0% 07/16 99`% 1% 0% 0% 0% 03/16 99% 1% 0% 0% 08116 100% U° 0% 0% 0% )fd10 /7% 2% I% 0% 0% • 09/16 99% 1% 0% 0% 0% 09/10 100% 0'.% 0% 0% 0% 10/16 99,4 114, 0% 0% 0% ilk r:' onf3nuous Payment _ Insufficient information to produce i;: CoMbined Payment Trends �� — Newly Reported Paymnnt'i'ronds 100% chart. 100% ,r,y °% � eoRa' f ;rE 60% tau • 40% j 40% r._ ,.,..,,i 20% i - 209 606 t1 0% Current1-30 31.8061-90 >90 Currenf1.30 31.8061-30>90 __ — ' 'Continuous distribution with DOT— 'Combined distribution with DOT Back In top Trade Payment Information Payment Experiences(Financial Trades) Supplier Category Reported Date Activity Date Payment Terms Recent High Credit Balance Current Up to 30 DOT 31-60 DOT 61-90 DOT >90 DOT Continents' Bldg Main 9/23/16 £/06/16 Rev Si.190 $303 Cr'ad Card 10/06/16 Ito/ Crud Card 90/08/16 Rev ('lased,CuCreel Card 9/13/11; 1/28/09 Rei, Closed, u Foci Svcs 11/'14/13 11/01/13 Not.30 616,645 Accou tI Cl Find Saco 9/37/14 9/1 3/14 Not 30 $20"070 Find Socs 10/01115 9111/15 Mn $35,964 Fn1Gl Sacs 10/05/10 9/12116, Mo :4.a3AC u1tCI Foci Svcs I0/05/16 9/12/10 foto $24.5666 $9:1..17 Salisimch? (?ffc SuPPI 9t12116 fiev Closec.Cu 06c.Sup 01 9112/10 0/31/10 Rev $571 3200 • Madeline oxpurfences(Continuous Trades) Supplier Category Reported Delo,Activity Date Payment Terms Recent high Credit Balance Current Up to 30 DBT 31.60 DOT 61.90 DOT >90 DOT'Comments commune:9i 9/01/1,3 Var/nd $110 3116 45% 55% Comnlunictn 9/01/16 Vaned $90 $79 100% Corium/Nein 7101/10 Vetted $107 $107 100% Oust 0.3 Yr Packaging 10/04/16 Not 30 54,670 $3.737 56% 4% Plumbing 71:;1113 7111; Not 10 Plumbing 8/31/10 8/16 Net10 $11 232 9331 100% j Additional Tradeilne Experiences(Aged Yr ides) Supplier Category.Reported Date Activity Date Payment Terms Recent High Credit Dalance Currant Up to 30 D511 31.00 Df3T 91.001.)13T >90 DDT Comments Air TOM 9/01/15 0I01!14 Other $13 $13 100% Distntua 1/31/14 Nut90 91/64 ... ..__1 AA e'0-a init o/nn14 sber.Bxperian,eom -735848552 -Haber& Sons Plumbing, Inc 1'age�+or4 • • Plumbing 0130114 0114 Net 10 37.337 5313 100% Payment Trends Date Industry' DOT Industry" Current Up to 30 013T 3160 013T 61.00 013T >00 DOT DOT Current • t0/lij 5 0 87% .99% 1% (i 4.. 0% 0% 00116 5 U 87% 53% 1% 0% 0% 0% 00,0 0 01'/ 100% 0% 0%. 0•:., 0% 5 07/13 5 0 57% 50% 1% 0% 0% 0% 0311(1 5 1 51% 013% 2% 2% 0% 0% 05118 6 1 67% 0(3% 2% 2% 0% 0% 'Industry:Plumbing,Hosting 8,A1C Contractors Beck to top UCC Filings Dale' 01(18;2015 Filing Numbot 201502027657 • Jurisdiction. Sec Of Stote 1=1. I Secured Party. U S Canton/Bank Fl Miami 33172 2301 NW 07 Avenue I` Act ally• 1erninaled Dew 04/22/2014 Feting Number 201401269077 Jurisdiction' Sec Or Stair FL Activity: Continued Date: 0711512000 Filing Number 200000515562d Jurisdiction. Sec Of State FL Securers Pally. U S Century flank FL Miami 33172 2:301 NW 81 Avenue Collateral. (teat Properly,Accounts Receivable.Equipment,Furnishings and Fixtures,Inventory.Other Assets(undefined) i Activity Filed Bank o top UCC Filings Summary • Filing Period Cautionary Filings Total Filed Total Released Total Continued Amended t Assigned 0710 112 01E 0 0 0 0 0 01/01120/6 0 0 0 0 0 0710112015 0 0 0 0 0 01/01/2010 0 0 0 0 n 02'0112014 0 0 0 0 0 07/01/2014 1 1 1 1 0 Cautionary UCC Filings include one or more of the tollownt0 collateral,Accounts Accounts Receivable,Contracts Hereafter ec,aulrerJ property Leases Notes Ronsieahie,or Proceeds. . 'The Information herein Is furnished In confidence for your exclusive use for legitimate business purposes and shall not be reproduced.Neither Experian nor its sources or distributors warrant such information nor shall they be liable for your use or reliance upon It, 1:,120.10 Expedite Information Solutions Inc, . Back to lop ContIGt us Score Pi:.uulnr Leda;tonna Prroacy 201,5 Espenen Information Solutions,Inc All rights iesen•ed F..po;i:lrXII-..lE•0,11•.3,:t01/,;:1',.E 3.54,ire,w,,av _,:,,,,.11•14,,,,,••• r:.4•_,a'' ', 0 - . . ... ... --e.n ..._.._.._1 nnC 0.A 1(1/147/1(114 . Report Summary . Page 1 of 4 Oct 18, 2016-3 Bureau Report+FICO®Score fu: Experian® Equifax® TransUnion® Compare All 3 Credit Reports Prepared for Jose Haber on Oct 18, 2016 Refresh your Experian Credit Report every 30 days. > Refresh your report Summary Your summary includes the information that identifies this Report as yours, as well as summaries of the other sections of the Report. If you have a personal statement as a result of a dispute, it will appear here as well. n on a MyFICO®Scores °°°� a a 4{< oa�o�a .Xpc,rin �� ., 'n:' TransUnion -:..r 031 n,, If 792 , 795 rk {' 810 , Very Good Very Good r Exceptional V. 0, 300 850300 850 300 850 FICO Score 8 based FICO Score 8 based FICO Score 8 based on Experian data as on Equifax data as on TransUnion data of Oct 18, 2016 of Oct 18, 2016 as of Oct 18, 2016 Compare Score Details "44° • x; My Accounts SummaryatlllGpExperian uit / " TrtriliY {oPLa e o Open Credit Cards 0 2 2 2 Open Retail Cards 0 2 2 2 Open Real Estate Loans 0 0 0 0 Open Installment Loans 0 0 0 0 Total Open Accounts 0 4 4 4 , u „ . , Report SummaryPage 2 of 4 Accounts Ever Late 0 1 0 0 0 Collections Accounts 0 0 0 0 Time Since Negative 0 — — — Average Account Age'i. 11 yrs 10 yrs 8 mos 10 yrs 8 mos Oldest Account 0 33 yrs 33 yrs 33 yrs e4.a)a My Overall Credit Usage ;®eea�$ligExperian i0,411W-' '' ' Irc�r�stlt�is�ri 10% 10% 8% Credit Debt Credit Debt Credit Debt $2,642 $2,642 $2,049 Total Credit Total Credit Total Credit $25,400 $25,400 $25,400 e ee a i My Debt Summary lag'Experian EMIN TransUnion 0 0 O Credit and Retail Card Debt 0 $2,642 $2,642 $2,049 Real Estate Debt 0 $0 $0 $0 Installment Loans Debt >i $0 $0 $0 Collections Debt m: $0 $0 $0 Total Debt 0 $2,642 $2,642 $2,049 a My Hard Credit Inquiries :Imp Experian MUMMY( `� �I"r"Citlsllryic�rl-` 'a A 0 , Number of Inquiries 0 6 3 2 9 Report Summary • Page 3 of 4 °„��9 xp riar� (u a My Public Records °„1: ; rW �rcnisli �ion Number of Public Records 0 e oe o a MyPersonal Information °°as ExperianEQUIP';;: '1'rarast.lni•ri« ab Name 0 . JOSE HABER JOSE HABER JOSE HABER Also Known As 0 JOSE HABER JOSE HARBER None reported Birth Year 0 1950 1950 1950 Addresses® 5171 SW 5TH TER 4106 NW 37TH CORAL GABLES, AVE MIAMI, FL FL 33134 5171 5TH TE#54 33142-4222 337 EAST 8TH ST CORAL GABLES, 5171 SW 5TH ST HIALEAH, FL FL 33134 CORAL GABLES, 33010 4106 37TH AV FL 33134-1363 5171 NW 5 TER MIAMI, FL 33142 5171 SW 5 MIAMI, FL 33134 5171 SW5TH TE TERRAS MIA, FL 4424 NW 74TH CORAL GABLES, 33134 AVE MIAMI FL 33134 SPRINGS, FL 33166 Employers 0 ; HABER INSTALL HABER SONS PLUMB HABER SONS PLUMBING INC TRUST PLUMBING SELF FORWARDING HABERSONS INC PLUMB TECH Personal Statement(s)0 No Statement(s) No Statement(s) No Statement(s) present at this time present at this time present at this time Q Is everything correct? Be sure to review your Credit Report for any unfamiliar information. If you find inaccurate information, you can either dispute the information online or via postal mail. View Our Disputes Guide View Accounts i „ 11 Report Summary Page 4 of 4 • #/print/experian/201610181611025185 Page 1 of 23 VS1' ®® Xl � ..-..9 ri a n • • 4L A) Credit Report Prepared For: JOSE HABER Experian Report As Of: Oct 18,2016 Personal&Confidential A/1 A/1/11 / #/printlexperian/201610181611025185 Page 2 of 23 0 00 O JOSE MASER•Experian 00,18 p� Date of Report:Oct 18,2016 "°O°:Experian 0 0 0 ,... .�,.w., . .. .. , Account Summary My Accounts Summary My Overall Credit Usage Open Credit Cards 2 Credit Debt $2,642 Open Retail Cards 2 10% , Total Credit Open Real Estate Loans 0 $25,400 Open Installment Loans 0 Total Open Accounts 4 My Debt Summary Accounts Ever Late 0 Credit and Retail Card Debt $2,642 Collections Accounts 0 Real Estate Debt $0 Average Account Age 11 yrs Installment Loans Debt $0 Oldest Account 33 yrs Collections Debt $0 newest account O• Total Debt $2,642 , My Hard Credit Inquiries i My Public Records 6 0 Sumrnary . Accounts Collections__ Inquiries Public Records Credit Scot-e #/print/experiani201610181611025185 Page 3 of 23 ea o JOSE HABER-Experian 00000 bate of Report:Oct 18,2016 , Experian Account Summary �. ,.... My Personal Information Name JOSE HABER Also Known As JOSE HABER Birth Year 1950 Addresses Personal Statement(s) 4106 NW 37TH AVE MIAMIFL 33142.4222 No Statement(s)present at this time , 5171 SW STH ST CORAL GABLES,FL 33134-1363 5171 SW 5 TERRAS MIA,FL 33134 Employer(s) HABER SONS PLUMBING INC SELF Surlirrrary Accounts Collections Inquiries Public Records Credit Score .n 11 11 f.1 A 1 f 4/print/experian/201610181611025185 Page 4 of 23 > a, o JOSE HABER-Experlan o°oO0°e e Date of Report:Oct 18,2016 :LJ:Experian Open Accounts _ CBNA Open •,, Open ACCOUNT DETAILS CREDIT USAGE Account Name CBNA •t No Credit Usage You have no account balance.Keeping your account 50499414XXXX �, 0% balances as low as possible can have a positive Account# Impact on your credit. Account Status Open Last Updated Sep 30,2016 CONTACT INFORMATION , Account Type Revolving Charge Account u ._. N.. . • ...__ ". PO BOX 6189 Date Opened Mar 1,2014 SIOUX FALLS,SD 57117 BYMAILONLY Balance $0 PAYMENT HISTORY Credit Limit $2,000 Monthly Payment $32 2016 2015 2014 Jen Feb Mar Apr Jan Feb Mar Apr Jan Feb Mar Apr OOOO DEE 3121 0000 OK OK OK OK OK OK OK OK OK OK Past Due Amount May Jun Jul Aug May Jun Jul Aug May Jun Jul Aug Payment Status Current DODO OOOE 000O0 , Sep Oct Nov Dec Sep Oct Nov Dec Sep Oct Nov Dec Highest Balance $218 CMC1 OK OK OK® OK OK OK OK Terms Revolving Responsibility Individual Comments - it . q Summary Accounts(Open) Collections Inquiries Public Records Credit Score #,/print/experian/201610181611025185Page 5 of 23 0 00 Y JOSE HABER•Experianeemoe Date of Report:Oct 18,2016 " Experian o s a CBNA Open 512107225191XXXX ACCOUNT DETAILS CREDIT USAGE Account Name CBNA kW Low Credit Usage Keeping your account balances as low as possible Account# 512107225491XXXX „ 4% . can have a positive Impact on your credit. Account Statue Open Last Updated Sep 17,2016 CONTACT INFORMATION Account Type Credit Card-RevoNIn Terms �..__.._......._... PO BOX 6283 Date Opened Oct 1,1983 SIOUX FALLS,SD 57117 (900)917-1700 Balance $366 PAYMENT HISTORY cram Limit $10,000 _.,..:, .., :..:.,.,, ._.:,, 2016 2016 2014 Monthly Payment $27 Jan Feb Mar Apr Jan Feb Mar Apr Jan Feb Mar Apr OK OK OK OK OK OK OK OK OK OK OK OK Past Due AmountMay Jun Jul Aug May Jun Jul Aug May Jun Jul Aug Payment Status CUffent0000 0000 DC)DD ,. _ _ Sep Oct Nov Dec Sep Oct Nov Dec Sep Oct.Nov Dec i Highest Balance $2,858 OK 0 00 OK OK OK OK 0000 I Terms Revolving 2013 2012 2011 Jan Feb Mar Apr O®00 DDD Jan Feb Mar Apr Respansibllity Individual OK OK OK DEED OK OK OK OK OK OK May Jun Jul Aug. May Jun Jul Aug May Jun Jul Aug Comments - DEED DEED DEED Sep Oct Nov Dec Sep Oct Nov Dec Sep Oct Nov Dec 0000 000 OK OK OK OK pK 2010 2009 Jan Feb Mar Apr Jan Feb Mar Apr _ K OK OKa DODO . May Jun Jul Aug May Jun Jul Aug OK OK OK OK 0000 Sep Oct Nov Dec Sep Oct Nov Dec OK OK OK OK DEED -.....:,.,.,-,-..----. -_.�. ..+,..-...,.--.�-.-,err—+n.,.._.rn.,.�—�"._'.--..-.ate—.r.—...—.— ..�,.--r.�.,.--....�.,-,.ra--,-..,,...�-,-,..-.r-e..-,—.�-.•--,--....,,--.•Y...•-.r IJ Summary Accounts(Open) Collections Inquiries Public Records Credit Score tnno/'1n1ti #/print/experian/201610181611025185 Page 6 of 23 JOSE HABER-Experianea00 Date or Report;Oct 18,2016 1601:jo$:Experian DISCOVER FIN SVCS LLC Open 60110043XXXX ACCOUNT DETAILS CREDIT USAGE Account Name DISCOVER FIN SVCS LLC Low Credit Usage Keeping your account balances as low as possible Account# 60110040XXXX 21% .• can have a positive impact on your credit. Account Status Open Last Updated OCt 10,2016 CONTACT INFORMATION Account Type Credit Card-Revolving Terms ..... PO BOX 15318 Date Opened Jul 1,1986 WILMINGTON,DE 19850 Balance $2,278 BYMAILONLY PAYMENT HISTORY Creat Limit $11,000 Monthly Payment $46 2016 2018 2014 Jan Feb Mar Apr Jan Feb Mar A r Jan Feb Mar Apr 0000 0000 0000 Past Due Amount OK OK OK OK OK OK OK OK OK OK OK OK May Jun Jul Aug May Jun Jul Aug May Jun Jul Aug Payment Status Current OK OK DC] KOK OK OK OK OK 0002 sep Oct Nov Dec Sep Oct Nov Dec Sep Oct Nov Dec Highest Balance $3,590 OK OK 00 OK OK OK OK O OK OK OK Terms Revolving 2013 Jan Feb Mar Apr Responsibility Individual 00 00 ..._. .. - ... May Jun Jul Aug Commenta - CID OD Sep Oct Nov Dec OK OK OK OK Sumrrmra,y Accounts Open) Collections Inquiries Public Records Credit Score • { 9 #/print/experian/201610181611025185 Page 7 of 23 JOSE HABER-Experian Date of Report Oct 18,2016 :Oesgca Experian MCYDSNB Open 603534001048XXXX ACCOUNT DETAILS CREDIT USAGE Account Name MCYDSNB No Credit Usage You have no account balance.Keeping your account Account# 603534001048XXXX oo balances as low as possible can have a positive Account Status Open Impact on your credit. Last Updated Oct 11,2016 CONTACT INFORMATION Account Type Revolving Charge Account 9111 DUKE BLVD Date Opened Sep 1,2015 MASON,OH 45040 Balance $0 (800)243-6552 PAYMENT HISTORY Credit Limit $2,400 Monthly Payment $27 2016 2016 Jan Feb Mar Apr Jan Feb Mar Apr 0000 0000 Past Due Amount oK QK OK OK May Jun Jul Aug May Jun Jul Aug Payment Status Current OK OK OK QK 0000 ..,.�..... Sep Oct Nov Dec Sep Oct Nov Dec Highest Balance $524 oK oK 00 DODD Terms ._. Revolving Responsibility Individual Comments - Summary Accounts(Open) - Collections Inquiries Public Records Credit Score is 1(1(r1!1 1 #/print/experian/2016101816'l 1025185 Page 9 of 23 JOSE HABER-Experian aegom Date of Report:Oct 18,2016 lei:Experian O O • CITI/CBNA cioeed 803525301216XXXX ACCOUNT DETAILS CREDIT USAGE Account Name CITI/CBNA Unknown Credit Usage Credit usage could not be calculated for this account Account C 603525301216XXXX N/A because either the balance and/or credit limit were not reported. Account Status Closed Last Updated Jan 18,2013 CONTACT INFORMATION i Account Type Revolving Charge Account --.—. ...::..... _...._.... 701 E BOTH ST N Date Opened Nov 1,2000 SIOUX FALLS,SD 57104 BYMAILONLY Balance - PAYMENT HISTORY Credit Limit $3,000 2013 2012 2011 Monthly Payment - Jan Feb Mar Apr Jan Feb Mar Apr Jan Feb Mar Apr .._., MOO 0000 0000 OK OK OK OK OK OK OK CIS Past Due Amount May Jun Jul Aug May Jun Jul Aug May Jun Jul Au e.._._ 0000 0000 DOE K Payment Status Paid satisfactorily ODE OK OK DOE OK OK Sep Oct Nov Dec Sep Oct Nov Dec Sep Oct Nov Dec i Highest Balance 54,853 000❑ 0000 OK OK OD Terms Revolving 2010 2009 Jan Feb Mar Apr Jan Feb Mar Apr Responsibility Individual OK OK OK OK OOOO May Jun Jul Aug May Jun Jul Aug Comments - O OK C30 0000 Sep Oct Nov Dec Sep Oct Nov Dec OK OK OK OK DODO J -....r..v+.....-•,.. --m�r*r•..-.ti-��-e-. �.....-+v+---r .+.-•-ar_.-�xa-e.r,.-r-�-... :-,... ,�. ._ I Summary Account:(Closed) . Collections Inquiries Public Records Credit Score , #/print/experian/201610181611025185 Page 8 of 23 CI 00 JOSE HABER•Experian e8am8c Date of Report:Oct 18,2016 :seam:Experian :.�... :.....,. Closed Accounts .. AMERICAN HONDA FINANCE Closed 12852XXXX ACCOUNT DETAILS CONTACT INFORMATION Account Name AMERICAN HONDA FINANCE Po BOX 1027 ALPHARETTA,GA 30009 Account# 12852XXXX _._.._,......:......... _......._.-........... ..._....._.._...... .._.......... PAYMENT HISTORY Account Status Closed Last Updated Nov 23,2011 b10 b Mar Feb Mar Apr Jan Feb Mar Apr C CODE C}CO OK OK OK OK OK OK Account Type Auto Loan Ma Jun OouKAC CCJOx Date Opened Mar 1,2010 C4CACu oK Sep Oct Nov Dec Sep Oct Nov Dec Balance • 0000 OK OK OK OK Original Balance $17.524 Monthly Payment - Past Due Amount - Payment Status Paid satisfactorily Highest Balance - Terms 60 Months Responsibility Individual Comments Stummary Accounts(Closed) Collections inquiries Public Records U dit Score ##/print/experian/201610181611025185 . . Page 10 of 23 n 00 0 JOSE HABER-Experian f n6e Date Of Report Oct 18,2016 :LP Experian SUNTRUST BK MIAMI NA Closed 70200C0702157XXXX ACCOUNT DETAILS CONTACT INFORMATION Aocount Name SUNTRUST BK MIAMI NA PO BOX 524203 MIAMI,FL 33152 Account# 7020000702157XXXX (305)591-8304 Account Status Closed PAYMENT HISTORY Last Updated Dec 30,2013 2013 2012 Jan Feb Mar Apr Jan Feb Mar Apr Account Type Business Loan Personally Guaranteed DODO ODE CI Mar 12012 May Jun Jul Aug May Jun Jul Aug , 0000 KOK OK OK Date Opened OK OK OK OK Sep Oct Nov Dec Sep Oct Nov Dec .• • Balance - OK OK OK OK 0000 Original Balance $22,390 Monthly Payment Past Due Amount _ Payment Status Pald satisfactorily Highest Balance " Terms 60 Months Responsibility Joint Account Comments _ `iun7maly • Accounts (Closed) Collections Inquiries Public Records Credit Score ,A/Ior'Ait #/print/experian/201610181611025185 Page 11 of 23 e as o JOSE HABER-Experian e2°a,t, Date of Report:Oct 18,2016 a2040 o Experian SYNCBIBRANDSMART Closed 60191701XXXX ACCOUNT DETAILS CREDIT USAGE • Account Name SYNCS/BRANDSMART Unknown Credit Usage Credit usage could not be calculated for this account Account n 60191701 XXXX N/A because either the balance and/or credit limit were not reported. Account Status Closed Last Updated Jul 14,2016 CONTACT INFORMATION Account Type Revolving Charge Account PO BOX 965036 Date Opened Feb 1,2009 ORLANDO,FL 32896 (866)396-8254 Balance PAYMENT HISTORY Credit LImlt $3,000 Payment 2016 2016 2014 Monthly y Jan Feb Mar Apr Jan Feb Mar Apr Jan Feb Mar Apr Peet Due Amount - OK OKOK O OK OK OK�-•.� OK OK OK OK May Jun Jul Aug May Jun Jul Aug May Jun Jul Aug Payment Status Pald satisfactorily OK OK OK O OK OK OK OK El OK OK OK Sep Oct Nov Dec Sep Oct Nov Dec Sep Oct Nov Dec Highest Balance $2,672 0000 OK OK OK OK 0000 Terms Revolving 2013 2012 2011 Jan Feb Mar Apr Jan Feb Mar Apr Jan Feb Mar Apr Responsibility Individual 0000 OK OK OK OK El OK O OK May Jun Jul Aug May Jun Jul Aug May Jun Jul Aug Comments - 0000 OK OK OK OK OK OK OK OK Sep Oct Nov Dec Sep Oct Nov Dec Sep Oct Nov Dec OK O OK Q OK OK OK OK 0000 2010 2009 Jan Feb Mar Apr Jan Feb Mar Apr OE OK OK DO(]C May Jun Jul Aug May Jun Jul Aug OK OK OK OK rno OK Sep Oct Nov Dec Sep Oct Nov Dec OK OK OK OK OK OK OK OK it Summary Accounts (Closed) Collections Inquiries Public Records Credit Score • .• • 1n/1o/-A14 #/print/experian/201610181611025185 Page 14 of 23 o ua o JOSE HABER-Experian „P"$ Date of Report Oct 18,2016 n0ooee ExpePnan SYNCB/LOWES Closed 79019241XXXX ACCOUNT DETAILS CREDIT USAGE Account Name SYNCB/LOWES Unknown Credit Usage Credit usage could not be calculated for this account Account a 79819241 XXXX N/A because either the balance and/or credit limit were not reported. Account Status Closed Last Updated Sep 21,2014 CONTACT INFORMATION Account Type Revolving Charge Account PO BOX 985005 Date Opened Apr 1,2010 ORLANDO,FL 32896 (800)444-1408 Balance - PAYMENT HISTORY Credit Limit $0 2014 2013 2012 Monthly Payment Jan Feb Mar Apr Jan Feb Mar Apr Jan Feb Mar Apr Past Otte Amount - OE C612OK OK OK OK OK OK OK OK May Jun Jul Au May Jun Jul Aug May Jun Jul Aug Payment Statue Paid satisfactorily CID OK OK OK L2U4 CO 0000 Sep Oct Nov Dec Sep Oct Nov Dec Sep Oct Nov Dec Highest Balance $2,724 OK 0 O❑ OK CID OK C101:30 Terms Revolving 2011 2010 Jan Feb Mar Apr Jan Feb Mar Apr Responsibility Individual 0000 000E May Jun Jul Aug May Jun Jul Aug Comments - OK CO OK OK OK OK Sep Oct Nov Dec Sep Oct Nov Dec 0=0 OK OK OK OK .Summary Accounts (Closed) Collections Inquiries Public Records C'reydit Score I/print/experian/201610181611025185 Page 15 of 23 4 Oa 0 OA9r1 , JOSE HABER-Experlan "m o. X@��r{�I1 Date of Report:Oct 18,2016 mec1e" SYNCS/ROOMS TO GO Closed 60191912XXXX ACCOUNT bDTAILS GREDIT USAeg Account Name SYNCB/ROOMS TO GO Unknown Credit Usage Credit usage could not be calculated for this account Account 0 60191912XXXX N/A because either the balance and/or credit limit were not reported. Account Status Closed Last Updated May 17,2013 CONTACT INFORMATION Account Type Revolving Charge Account PO BOX 965036 Date Opened Jan 1,2010 ORLANDO,FL 32896 (866)396-8254 Balance PAYMENT HISTORY Credit Limit $6,000 2013 2012 2011 Monthly Payment Jan Feb Mar Apr Jan Feb Mar Apr Jan Feb Mar Apr OK OK OK 0 OK DK O OK OK OK OK OK Past Due Amount May Jun( OKJul Aug May Jun Jul Aug May Jun Jul Aug OK Paid satisfactorily 0000 OK OK OK OK OK OK OK Payment Status Sep Oct Nov Dec Sep Oct Nov Dec Sep Oct Nov Dec Highest Balance $1,611 0000 00C:10 0000 Revolving 2010 2009 Terme Jan Feb Mar Apr Jan Feb Mar Apr • oK Individual Q oK l 1 0000 Responsibility May Jun Jul Aug May Jun Jul Aug - OK OK OK OK 0000 Comments Sep Oct Nov Dec Sep Oct Nov Dec 0000 0000 , Suinmary Accounts (Closed) Collections Ingeriries Public Records Credit Score 1/1/1 QP1n14 Detail by FEI/EIN Number Page 1 of 2 Florida Department of State DIVISION OF CORPORAT ONS INV gjrJ f it.„220. 2— 2 2, Department of State / Division of Corporations / Search Records / Detail By Document Number/ Detail by FEI/EIN Number Florida Profit Corporation HABER&SONS PLUMBING, INC. Filing Information Document Number P98000056857 FEI/EIN Number 65-0845989 Date Filed 06/25/1998 State FL Status ACTIVE Principal Address 4106 NW 37 AVE MIAMI, FL 33142 Changed:01/09/2006 Mailing Address 4106 NW 37 AVE MIAMI, FL 33142 Changed:01/09/2006 Registered Agent Name&Address HABER,JOSE 5171 S.W. 5TH TERRACE MIAMI, FL 33134 Officer/Director Detail Name&Address Title P HABER,JOSE 5171 S.W. 5TH TERRACE MIAMI, FL 33134 Annual Reports Report Year Filed Date 2015 01/05/2015 2016 01/04/2016 2017 01/03/2017 http://search.sunbiz.org/Inquiry/CorporationSearch/SearchResultDetail?inquirytype—FeiNu... 2/22/2017 Detail by FEI/EIN Number Page 2 of 2 Document Images 01/03/2017--ANNUAL REPORT View image in PDF format 01/04/2016--ANNUAL REPORT View image in PDF format 01/05/2015--ANNUAL REPORT View image in PDF format 01/08/2014--ANNUAL REPORT View image in PDF format 01/14/2013--ANNUAL REPORT View image in PDF format 01/18/2012--ANNUAL REPORT View image in PDF format 01/05/2011--ANNUAL REPORT View image in PDF format 01/18/2010--ANNUAL REPORT View image in PDF format 01/06/2009--ANNUAL REPORT View image in PDF format 01/14/2008--ANNUAL REPORT View image in PDF format 02/12/2007--ANNUAL REPORT View image in PDF format 01/09/2006--ANNUAL REPORT View image in PDF format 02/08//2005--ANNUAL REPORT View image in PDF format 04/12/2004--ANNUAL REPORT View image in PDF format 01/30/2003--ANNUAL REPORT View image in PDF format 01/30/2002--ANNUAL REPORT View image in PDF format 01/23/2001--ANNUAL REPORT View image in PDF format 04/03/2000--ANNUAL REPORT View image in PDF format 03/10/1999--ANNUAL REPORT View image in PDF format 06/25/1998--Domestic Profit View image in PDF format Flonna Department of Some,Div slen of Corporatmns http://search.sunbiz.org/Inquiry/CorporationSearch/SearchResultDetail?inquirytype=Fei Nu... 2/22/2017 ATTACHMENT D INSURANCE REQUIREMENTS APPENDIX F Cr_.4 MIAMI BEACH Insurance Requirements ITB 2017-039-JC Plumbing Services PROCUREMENT DEPARTMENT 1755 Meridian Ave. 3rd Floor Miami Beach, Florida 33139 ITB 2017-039-JC 38 MIAMI BEAH INSURANCE REQUIREMENTS This document sets forth the minimum levels of insurance that the contractor is required to maintain throughout the term of the contract and any renewal periods. XXX 1. Workers'Compensation and Employer's Liability per the Statutory limits of the state of Florida. XXX 2. Comprehensive General Liability (occurrence form), limits of liability$ 1,000,000.00 per occurrence for bodily injury property damage to include Premises/ Operations; Products, Completed Operations and Contractual Liability. Contractual Liability and Contractual Indemnity (Hold harmless endorsement exactly as written in"insurance requirements"of specifications). XXX 3. Automobile Liability-$1,000,000 each occurrence-owned/non-owned/hired automobiles included. 4. Excess Liability-$ .00 per occurrence to follow the primary coverages. XXX 5. The City must be named as and additional insured on the liability policies; and it must be stated on the certificate. 6. Other Insurance as indicated: _Builders Risk completed value $ .00 Liquor Liability $ .00 _Fire Legal Liability $ .00 Protection and Indemnity $ .00 —Employee Dishonesty Bond $ .00 _Other $ .00 XXX 7. Thirty(30)days written cancellation notice required. XXX 8. Best's guide rating B+:VI or better,latest edition. XXX 9. The certificate must state the proposal number and title The City of Miami Beach is self-insured. Any and all claim payments made from self-insurance are subject to the limits and provisions of Florida Statute 768.28, the Florida Constitution, and any other applicable Statutes. ITB 2017-039-JC 39 IAMI BEACH City of Miami Beach, 1755 Meridian Ave, 3rd Floor,Miami Beach, Florida 33139,www.miamibeachfl.gov PROCUREMENT DEPARTMENT Tel: 305-673-7490, Fax: 786-394-4010 March 1, 2017 Haber&Son's Plumbing, Inc Mr. Jose Haber . 4106 NW 37 Avenue Miami, FL. 33142 Subject: INVITATION TO BID (ITB) 2017-039-JC for Plumbing Services. Dear Mr. Haber: This letter shall serve as notification that the Mayor and City Commission, at its February 8, 2017 meeting, approved a recommendation to award a contract to Haber & Son's Plumbing, Inc., for Plumbing Services, pursuant to the above referenced ITB. The purpose of this letter is to inform you that agreements must be executed prior to the issuance of a Purchase Order, which is required for any work to be performed. Included with this correspondence is one(1)agreement book. To complete the execution of the agreements and before proceeding with the issuance of a Purchase Order, please provide the following: 1. Sign the signature pages where indicated ("sign here"). 2. Include the entire agreement and the three(3)signed signature pages,attested,dated,and with the corporate seal. .. 3. A certificate of insurance, with limits as indicated in the ITB, reflecting the City of Miami Beach as additional insured. Certificates need to include the following as Certificate Holder: The City of Miami Beach, Florida C/O Insurance Tracking Services, Inc. (ITS) P.O. Box 20270 Long Beach, CA 90801 miamibeach a(�instrackinq.com Please return all documentation to this office within five (5)calendar days. If you have any questions, please contact Mr. Jorge Gueimunde at 305-673-7490, or jorgegueimunde@miamibeachfl.gov. Thank you, Alex Denis Procurement Director