The URL can be used to link to this page

ITB 47-06/07 Monitoring Equipment for City GaragesINVITATION TO BID FOR THE PURCHASE AND INSTALLATION OF VIDEO MONITORING EQUIPMENT FOR CITY GARAGES BID # 47-06/07 BID OPENING: September 25, 2007 AT 3:00 P.M. Pamela: keit". CPPB PROCUREMENT DIVISION•! 1700 Convention Center Drive, Miami Beach, FL 33'139 www.miamibeachil.gov August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 1 of 43 33139, or FAX: (786) 394-4006. The Bid title/number shall be referenced on all correspondence. All questions must be received no later than ten (10) calendar days prior to the scheduled Bid opening date. All responses to questions/clarifications will be sent to all prospective bidders in the form of an addendum. The City of Miami Beach reserves the right to accept any proposal or bid deemed to be in the best interest of the City of Miami Beach, or waive any informality in any proposal or bid. The City of Miami Beach may reject any and all proposals or bids. YOU ARE HEREBY ADVISED THAT THIS INVITATION TO BID IS SUBJECT TO THE FOLLOWING ORDINANCES/RESOLUTIONS, WHICH MAY BE FOUND ON THE CITY OF MIAMI BEACH WEBSITE: htto://www.miamibeachfl.aov/newcity/dents/ourchase/bidintro.aso • CONE OF SILENCE – ORDINANCE NO. 2002-3378 • CODE OF BUSINESS ETHICS -- RESOLUTION NO. 2000-23879. • DEBARMENT PROCEEDINGS – ORDINANCE NO. 2000-3234. • PROTEST PROCEDURES -- ORDINANCE NO. 2002-3344. • LOBBYIST REGISTRATION AND DISCLOSURE OF FEES – ORDINANCE NO. 2002-3363 • EQUAL BENEFITS ORDINANCE – ORDINANCE NO. 2005-3494 • CAMPAIGN CONTRIBUTIONS BY VENDORS ORDINANCE NO. 2003-3389 • LIVING WAGE REQUIREMENT—ORDINANCE NO. 2001-3301. Pursuant to City of Miami Beach Living Wage Ordinance, as codified in Chapter 2, Division6, Section 2-407 thru 2-410 of the Miami Beach Code, all service contractors, entering into a contract with the city shall pay to all its employees, a living wage of not Tess than $8.56 an hour with health benefits, or a living wage of not less than $9.81 an hour without health benefits. For a covered employer to company with the living wage provision by choosing to pay the lower wage scale ($8.56/hour) when a covered employer also provides health benefits, such health benefits shall consist of payment of at least $1.25 per hour toward the provision of health benefits for covered employees and their dependents. Detailed representation of all these ordinances can be found on the City of Miami Beach website at htto://www.miamibeachfl.aovinewritvidepts/Durchaseibidintroasp Sincerely, f " Gus Lopez, CPPO Procurement Director August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 3 of 43 VIDEO MONITORING EQUIPMENT BID # 47-06/07 1.0 GENERAL CONDITIONS 1.1 SEALED BIDS: Original copy of Bid submission, as well as any other pertinent documents must be returned in order for the bid to be considered for award. All bids are subject to the conditions specified hereon and on the attached Special Conditions, Specifications and Bid Form. The completed bid plus three (3) copies must be submitted in a sealed envelope clearly marked with the Bid Title to the City of Miami Beach Procurement Division, 3rd floor, 1700 Convention Center Drive, Miami Beach, Florida 33139. Facsimile or e-mailed bids will not be accepted. 1.2 EXECUTION OF BID: Bid must contain a manual signature of an authorized representative in the space provided on the Bid Form. Failure to properly sign bid shall invalidate same and it shall NOT be considered for award. All bids must be completed in pen and ink or typewritten. No erasures are permitted. If a correction is necessary, draw a single line through the entered figure and enter the corrected figure above it. Corrections must be initialed by the person signing the bid. Any illegible entries, pencil bids or corrections not initialed will not be tabulated. The original bid conditions and specifications CANNOT be changed or altered in any way. Altered bids will not be considered. Clarification of bid submitted shall be in letter form, signed by Bidders and attached to the bid. 1.3 NO BID: If not submitting a bid, respond by returning the enclosed bid form questionnaire, and explain the reason. Repeated failure to bid without sufficient justification shall be cause for removal of a supplier's name from the bid mailing list. 1.4 PRICES QUOTED: Deduct any applicable trade discounts and quote firm net prices. Give both unit price and extended total, when requested. Prices must be stated in units of quantity specified in the bidding specifications. In case of discrepancy in computing the amount of the bid, the UNIT PRICE quoted will govern. All prices must be F.O.B. destination, freight prepaid (unless otherwise stated in special conditions). Any discounts for prompt payment should be specified. Award, if made, will be in accordance with terms and conditions stated herein. Cash or quantity discounts offered will not be a consideration in determination of award of bid(s). 1.5 TAXES: The City of Miami Beach is exempt from all Federal Excise and State taxes. State Sales Tax and Use Certificate Number is 85-8012621639C-9. 1.6 MISTAKES: Bidders are expected to examine the specifications, delivery schedules, bid prices and extensions and all instructions pertaining to supplies and services. Failure to do so will be at the Bidder's risk. August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 5 of 43 disposed of after thirty (30) days. Each individual sample must be labeled with Bidder's name. Failure of Bidder to either deliver required samples or to clearly identify samples may be reason for rejection of the bid. Unless otherwise indicated, samples should be delivered to the Procurement Division, 1700 Convention Center Drive, Miami Beach, FL 33139. 1.13 DELIVERY: Unless actual date of delivery is specified (or if specified delivery cannot be met), show number of days (in calendar days) required to make delivery after receipt of purchase order, in space provided. Delivery time may become a basis for making an award. Delivery shall be within the normal working hours of the user, Monday through Friday, excluding holidays, unless otherwise required. 1.14 INTERPRETATIONS: Unless otherwise stated in the bid, any questions concerning conditions and specifications should be submitted in writing to the Procurement Coordinator, 1700 Convention Center Drive, Miami Beach, FL 33139; E-mail PamelaLeia athmiamibeachfl.aov; Fax (786) 394-4006. 1.15 BID OPENING: Bids shall be opened on the date, time and place specified in this Bid document. All bids received after the date, time, and place shall be returned, unopened. 1.16 INSPECTION, ACCEPTANCE & TITLE: Inspection and acceptance will be at destination unless otherwise provided. Title to/or risk of loss or damage to all items shall be the responsibility of the successful Bidder until acceptance by the buyer unless loss or damage result from negligence by the buyer. If the materials or services supplied to the City are found to be defective or not conform to specifications, the City reserves the right to cancel the order upon written notice to the seller and return product at Bidder's expense. 1.17 PAYMENT: Payment will be made by the City after the items awarded to a vendor have been received, or services provided, inspected, and found to comply with award specifications, free of damage or defect and properly invoiced. Invoices must include the purchase order number. 1.18 DISPUTES: In case of any doubt or difference of opinion as to the items to be furnished hereunder, the decision of the City shall be final and binding on both parties. 1.19 LEGAL REQUIREMENTS: Federal, State, county and city laws, ordinances, rules and regulations that in any manner affect the items covered herein apply. Lack of knowledge by the Bidder will in no way be a cause for relief from responsibility. 1.20 PATENTS & ROYALTIES: The Bidder, without exception, shall indemnify and save harmless the City of Miami Beach, Florida and its employees from liability of any nature or kind, including cost and expenses for, or on account of, any copyrighted, patented, or unpatented invention, process, or article manufactured or used in the performance of the contract, including its use by The City of Miami Beach, Florida. If the Bidder uses any design, device or materials covered by letters, patent, or copyright, it is mutually understood and agreed, without exception, that the bid prices shall include all royalties or cost arising from the use of such design, device, or materials in any way involved in the work. August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 7 of 43 reserves the right to terminate any purchase order or contract resulting from this invitation at any time and for any reason, upon giving thirty (30) days prior written notice to the other party. 1.30 BILLING INSTRUCTIONS: Invoices, unless otherwise indicated, must show purchase order numbers, and shall be submitted to the City of Miami Beach, Parking Department, 309 23 Street, Suite 200, Miami Beach, Florida, 33139; with a coov to the Accounts Payable Department, 1700 Convention Center Drive, Miami Beach, Florida 33139. 1.31 NOTE TO VENDORS DELIVERING TO THE CITY OF MIAMI BEACH: Receiving hours are Monday through Friday, excluding holidays, from 8:30 A.M. to 5:00 RM., unless otherwise indicated. The Parking Department is to be notified a minimum of one (1) business day prior to delivery. 1.32 SUBSTITUTIONS: The City will not accept substitute shipments of any kind without prior written approval from the City. Bidder(s) is expected to furnish the brand quoted in their bid once awarded, or as designated on the City's purchase order. Any non -authorized substitute shipments will be returned at the Bidder's expense. 1.33 FACILITIES: The City reserves the right to inspect the Bidder's facilities at any time with prior notice. 1.34 BID TABULATIONS: Bidders desiring a copy of the bid tabulation may request same by enclosing a self- addressed stamped envelope with the bid. 1.35 BID PROTEST PROCEDURES Bidders that are not selected may protest any recommendation for Contract award in accordance with City of Miami Beach Ordinance No. 2002-3344, which establishes procedures for resulting protested bids and proposed awards. Protest not timely pursuant to the requirements of Ordinance No. 2002-3344 shall be barred. 1.36 CLARIFICATION AND ADDENDA TO BID SPECIFICATIONS: If any person contemplating submitting a Bid under this Solicitation is in doubt as to the true meaning of the specifications or other Bid documents or any part thereof, the Bidder must submit to the City of Miami Beach Procurement Division at least ten (10) calendar days prior to scheduled Bid opening, a request for clarification. All such requests for clarification must be made in writing and the person submitting the request will be responsible for its timely delivery. Any interpretation of the Bid, if made, will be made only by Addendum duly issued by the City of Miami Beach Procurement Division. The City shall issue an Informational Addendum if clarification or minimal changes are required. The City shall issue a Formal Addendum if substantial changes which impact the technical submission of Bids are required. A copy of such Addendum shall be sent by RFP Depot via e-mail or facsimile to each Bidder receiving the Solicitation that is a subscriber to the RFP Depot notification system. Bidders who are not subscribers to the RFP Depot system are responsible for ensuring that they have received all addenda. In the event of conflict with the original Contract Documents, Addendum shall govern all other Contract Documents to the extent specified. Subsequent addendum shall govern over prior addendum only to the extent specified. The Bidder shall be required to acknowledge receipt of the Formal Addendum by signing in the space provided on the Bid Form. Failure to acknowledge Addendum shall deem its Bid non- responsive; provided, however, that the City may waive this requirement in its best interest. August 27, 2007 ITB No: 47-06/07 City of Miami Beach Video Monitoring Equipment 9 of 43 1.39 ASSIGNMENT: The contractor shall not assign, transfer, convey, sublet or otherwise dispose of this contract, including any or all of its right, title or interest therein, or his or its power to execute such contract to any person, company or corporation without prior written consent of the City of Miami Beach. 1.40 LAWS, PERMITS AND REGULATIONS: The Bidder shall obtain and pay for all licenses, permits and inspection fees required for this project; and shall comply with all laws, ordinances, regulations and building code requirements applicable to the work contemplated herein. 1.41 SPOT MARKET PURCHASES: It is the intent of the City to purchase the items specifically listed in this bid from the awarded vendor. However, items that are to be a Spot Market Purchased may be purchased by other methods, i.e. Federal, State or local contracts. 1.42 ELIMINATION FROM CONSIDERATION This bid solicitation shall not be awarded to any person or firm which is in arrears to the City upon any debt, taxes or contracts which are defaulted as surety or otherwise upon any obligation to the City. 1.43 WAIVER OF INFORMALITIES The City reserves the right to waive any informalities or irregularities in this bid solicitation. 1.44 ESTIMATED QUANTITIES Estimated quantities or estimated dollars, if provided, are for City guidance only. No guarantee is expressed or implied as to quantities or dollars that will be used during the contract period. The City is not obligated to place any order for a given amount subsequent to the award of this bid solicitation. Estimates are based upon the City's actual needs and/or usage during a previous contract period. The City for purposes of determining the low Bidder meeting specifications may use said estimates. 1.45 COLLUSION Bids from related parties. Where two (2) or more related parties each submit a bid or proposal for any contract, such bids or proposals shall be presumed to be collusive. The foregoing presumption may be rebutted by presentation of evidence as to the extent of ownership, control and management of such related parties in the preparation and submittal of such bids or proposals. Related parties mean Bidders or proposers or the principals thereof which have a direct or indirect ownership interest in another Bidder or proposer for the same contract or in which a parent company or the principals thereof of one (1) Bidder or proposer have a direct or indirect ownership interest in another Bidder or proposer for the same contract. Bids or proposals found to be collusive shall be rejected. Bidders or Proposers who have been found to have engaged in collusion may be considered non - responsible, and may be suspended or debarred, and any contract resulting from collusive bidding may be terminated for default. 1.46 DISPUTES In the event of a conflict between the documents, the order of priority of the documents shall be as follows: • Any agreement resulting from the award of this Bid (if applicable); then August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 11 of 43 the requirements stated in their Bid. 1.54 DELIVERY TIME: Bidders shall specify on the attached Bid Form, the guaranteed delivery time (in calendar days) for each item. It must be a firm delivery time, no ranges will be accepted, i.e.; 12-14 days. 1.55 CONE OF SILENCE This invitation to bid is subject to the "Cone of Silence" in accordance with Ordinance No. 2002-3378. A copy of all written communication(s) regarding this bid must be filed with the city clerk. 1.56 EQUAL BENEFITS FOR DOMESTIC PARTNERS Proposers are advised that this RFP and any contract awarded pursuant to this procurement process shall be subject to the applicable provisions of Ordinance No. 2005- 3494, entitled "Requirement for City Contractors to Provide Equal Benefits for Domestic Partners (the "Ordinance")." The Ordinance applies to all employees of a Contractor who work within the City limits of the City of Miami Beach, Florida; and the Contractor's employees located in the United States, but outside of the City of Miami Beach limits, who are directly performing work on the contract within the City of Miami Beach. All proposers shall complete and return, with their proposal, the "Declaration: Non- discrimination in Contracts and Benefits" form contained herein. The City shall not enter into any contract unless the proposer certifies that such firm does not discriminate in the provision of Benefits between employees with Domestic Partners and employees with spouses and/or between the Domestic Partners and spouses of such employees. Contractors may also comply with the Ordinance by providing an employee with the Cash Equivalent of such Benefit or Benefits, if the City Manager or his designee determines that: a. The Contractor shall complete and return the "Reasonable Measures Application" contained herein, and the Cash Equivalent proposed; AND. b. The Contractor shall complete and return the "Substantial Compliance Authorization Form" contained herein. It is important to note that Contractors are considered in compliance if Contractor provides benefits neither to employees' spouses nor to employees' Domestic Partners. 1.57 TERMINATION FOR DEFAULT If through any cause within the reasonable control of the successful Bidder, it shall fail to fulfill in a timely manner, or otherwise violate any of the covenants, agreements, or stipulations material to the Agreement, the City shall thereupon have the right to terminate the services then remaining to be performed by giving written notice to the successful Bidder of such termination which shall become effective upon receipt by the successful Bidder of the written termination notice. In that event, the City shall compensate the successful Bidder in accordance with the Agreement for all services performed by the Bidder prior to termination, net of any costs incurred by the City as a consequence of the default. August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 13 of 43 No change or cancellation in insurance shall be made without thirty (30) days written notice to the City of Miami Beach Risk Manager. All insurance policies shall be issued by companies authorized to do business under the laws of the State of Florida and these companies must have a rating of at least B+:VI or better per Best's Key Rating Guide, latest edition. Original signed Certificates of Insurance, evidencing such coverages and endorsements as required herein, shall be filed with and approved by the City of Miami Beach Risk Manager before work is started. The certificate must state Bid Number and Title. Upon expiration of the required insurance, the contractor must submit updated certificates of insurance for as long a period as any work is still in progress. It is understood and agreed that all policies of insurance provided by the contractor are primary coverage to any insurance or self-insurance the City of Miami Beach possesses that may apply to a Toss resulting from the work performed in this contract. All policies issued to cover the insurance requirements herein shall provide full coverage from the first dollar of exposure. No deductibles will be allowed in any policies issued on this contract unless specific safeguards have been established to assure an adequate fund for payment of deductibles by the insured and approved by the City's Risk Manager. The liability insurance coverage shall extend to and include the following contractual indemnity and hold harmless agreement: "The contractor hereby agrees to indemnify and hold harmless the City of Miami Beach, a municipal corporation, its officers, agents, and employees from all claims for bodily injuries to the public in and up to the amount of $1,000,000.00 for each occurrence and and for all damages to the property of others in and up to the amount of $1,000,000.00 for each occurrence per the insurance requirement under the specifications including costs of investigation, all expenses of litigation, including reasonable attorney fees and the cost of appeals arising out of any such claims or suits because of any and all acts of omission or commission of any by the contractor, his agents, servants, or employees, or through the mere existence of the project under contract". The foregoing indemnity agreement shall apply to any and all claims and suits other than claims and suits arising out of the sole and exclusive negligence of the City of Miami Beach, its officers, agents, and employees, as determined by a court of competent jurisdiction. The contractor will notify his insurance agent without delay of the existence of the Hold Harmless Agreement contained within this contract, and furnish a copy of the Hold Harmless Agreement to the insurance agent and carrier. The contractor will obtain and maintain contractual liability insurance in adequate limits for the sole purpose of protecting the City of Miami Beach under the Hold Harmless Agreement from any and all claims arising out of this contractual operation. The contractor will secure and maintain policies of subcontractors. All policies shall be made available to the City upon demand. Compliance by the contractor and all subcontractors with the foregoing requirements as to carrying insurance and furnishing copies of the insurance policies shall not relieve the contractor and all subcontractors of their liabilities and obligations under any Section or Provisions of this contract. Contractor shall be as fully responsible to the City for the acts and omissions of the subcontractor and of persons employed by them as he is for acts and August 27, 2007 ITB No: 47-06/07 City of Miami Beach Video Monitoring Equipment 15of43 ITB No. 47-06/07 Video Monitoring Equipment for City Garages INSURANCE CHECK LIST XXX 1. Workers' Compensation and Employer's Liability per the Statutory limits of the state of Florida. XXX 2. Comprehensive General Liability (occurrence form), limits of liability $ 1.000.000.00 per occurrence for bodily injury property damage to include Premises/ Operations; Products, Completed Operations and Contractual Liability. Contractual Liability and Contractual Indemnity (Hold harmless endorsement exactly as written in "insurance requirements" of specifications). XXX 3. Automobile Liability - $1,000,000 each occurrence - owned/non-owned/hired automobiles included. 4. Excess Liability - $ .00 per occurrence to follow the primary coverages. XXX 5. The City must be named as and additional insured on the liability policies; and it must be stated on the certificate. 6. Other Insurance as indicated: Builders Risk completed value $ .00 Liquor Liability $ .00 Fire Legal Liability $ .00 Protection and Indemnity $ .00 Employee Dishonesty Bond $ .00 Other XXX 7. Thirty (30) days written cancellation notice required. XXX 8. Best's guide rating B+:VI or better, latest edition. XXX 9. The certificate must state the bid number and title BIDDER AND INSURANCE AGENT STATEMENT: We understand the Insurance Requirements of these specifications and that evidence of this insurance may be required within five (5) days after bid opening. Bidder Signature of Bidder August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 17of43 2.7 PRE-BID CONFERENCE: A Pre-bid conference will be held on September 6, 2007 at 10:00 a.m. in the City Manager's Large Conference Room, Fourth Floor, City Hall, 1700 Convention Center Drive, Miami Beach, Florida 33139. Attendance (in person or via telephone) to this Pre-bid meeting is encouraged and recommended as a source of information, but is not mandatory. Bidders interested in participating in the pre-bid submission meeting via telephone must follow these steps: (1) Dial the TELEPHONE NUMBER: 1-800-915-8704 (Toll-free North America) (2) Enter the MEETING NUMBER: *2659980* (note that number is preceded and followed by the star (*) key). Bidders who are interested in participating via telephone, please send an e-mail to PamelaLeja@miamibeachfl.gov expressing your intent to participate via telephone at least one business day in advance of the meeting. 2.8 VENDOR APPLICATION The City of Miami Beach is utilizing RFP Depot, as an electronic procurement service for automatic notification bid notification opportunities and document fulfillment. RFP Depot allows for vendors to register online and receive notification of new bids, amendments and awards. Vendors with Internet access should review the registration options at the following website: www.rfpdepot.com If you do not have Internet access, please contact the RFP Depot's vendor support group at 800-990-9339 or 801-765-9245. 2.9 CONTACT PERSON: The contact person for this Invitation to Bid is Pamela Leja. The contact person may be reached by phone: 305.673.7490; fax: 786.394.4006; or e-mail: PamelaLeia(s miamibeachfl.00v. Communications between a proposer, Bidder, lobbyist or consultant and Procurement Staff are limited to matters of process or procedure. Requests for additional information or clarifications must be made in writing to the contact person, with a copy to the City Clerk, no later than ten (10) calendar days prior to the scheduled Bid opening date. The City will issue replies to inquiries and any other corrections or amendments it deems necessary in written addenda issued prior to the deadline for responding to the Bid. Bidders should not rely on representations, statements, or explanations other than those made in this Bid or in any written addendum to this Bid. Bidders should verify with the Procurement Division prior to submitting a proposal that all addenda have been received. YOU MUST FAMILIARIZE YOURSELF WITH GENERAL CONDITION 1.55, ENTITLED CONE OF SILENCE, WHICH SETS FORTH THE POLICIES AND PROCEDURES RELATIVE TO ORAL AND WRITTEN COMMUNICATIONS. 2.10 SAMPLES Samples of items, when required, must be furnished free of expense and, if not destroyed, will, upon request, be returned at the Bidder's expense. Bidders will be responsible for the August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 19 of 43 m MIAMIBEACH City of Miami Beach, 1700 Convention Center Drive; Miami Beach, Florida 33139, www.miamibeachfl.gov PROCUREMENT DIVISION Tei: 305-673-7490, Fax: 786.394.4006 Invitation to Bid (ITB) No. 47-06/07 PUBLIC NOTICE Sealed bids will be received by the City of Miami Beach Procurement Division, 3rd Floor, 1700 Convention Center Drive, Miami Beach, Florida 33139, until 3:00 p.m. on the 25th day of September 2007 for the PURCHASE AND INSTALLATION OF VIDEO MONITORING EQUIPMENT FOR CITY GARAGES At time, date, and place above, bids will be publicly opened. Any bids received after time and date specified will be returned to the Bidder unopened. The responsibility for submitting a bid before the stated time and date is solely and strictly the responsibility of the Bidder. The City is not responsible for delays caused by mail, courier service, including U.S. Mail, or any other occurrence. Purpose: The purpose of this ITB is to establish a contract, by means of sealed bids, with a qualified contractor for the purchase and installation of video monitoring equipment in City garages. A Pre-bid conference will be held on September 6, 2007 at 10:00 a.m. in the City Manager's Large Conference Room, Fourth Floor, City Hall, 1700 Convention Center Drive, Miami Beach, Florida 33139. Attendance (in person or via telephone) to this Pre-bid meeting is encouraged and recommended as a source of information, but is not mandatory. Bidders interested in participating in the pre-bid submission meeting via telephone must follow these steps: (1) Dial the TELEPHONE NUMBER: 1-800-915-8704 (Toll-free North America) (2) Enter the MEETING NUMBER: *2659980* (note that number is preceded and followed by the star (*) key). Bidders who are interested in participating via telephone, please send an e-mail to PamelaLeja@miamibeachfl.gov expressing your intent to participate via telephone at least one business day in advance of the meeting. The City of Miami Beach is utilizing RFP Depot, as an electronic procurement service for automatic notification bid notification opportunities and document fulfillment. RFP Depot allows for vendors to register online and receive notification of new bids, amendments and awards. Vendors with Internet access should review the registration options at the following website: www.rfodeoot.com If you do not have Internet access, please contact the RFP Depot's vendor support group at 800- 990-9339 or 801-765-9245. Any questions or clarifications concerning this Bid shall be submitted in writing by mail, e-mail, or facsimile to the Procurement Division, 3`a Floor, 1700 Convention Center Drive, Miami Beach, FL August 27, 2007 City of Miami Beach ITB No: 47-06107 Video Monitoring Equipment 2 of 43 33139, or FAX: (786) 394-4006. The Bid title/number shall be referenced on all correspondence. All questions must be received no later than ten (10) calendar days prior to the scheduled Bid opening date. All responses to questions/clarifications will be sent to all prospective bidders in the form of an addendum. The City of Miami Beach reserves the right to accept any proposal or bid deemed to be in the best interest of the City of Miami Beach, or waive any informality in any proposal or bid. The City of Miami Beach may reject any and all proposals or bids. YOU ARE HEREBY ADVISED THAT THIS INVITATION TO BID IS SUBJECT TO THE FOLLOWING ORDINANCES/RESOLUTIONS, WHICH MAY BE FOUND ON THE CITY OF MIAMI BEACH WEBSITE: http://www.miamibeachfl.aovineweitvidepts/ourchase/bidintro.aso • CONE OF SILENCE – ORDINANCE NO. 2002-3378 • CODE OF BUSINESS ETHICS -- RESOLUTION NO. 2000-23879. • DEBARMENT PROCEEDINGS – ORDINANCE NO. 2000-3234. • PROTEST PROCEDURES -- ORDINANCE NO. 2002-3344. • LOBBYIST REGISTRATION AND DISCLOSURE OF FEES – ORDINANCE NO. 2002-3363 • EQUAL BENEFITS ORDINANCE – ORDINANCE NO. 2005-3494 • CAMPAIGN CONTRIBUTIONS BY VENDORS ORDINANCE NO. 2003-3389 • LIVING WAGE REQUIREMENT—ORDINANCE NO. 2001-3301. Pursuant to City of Miami Beach Living Wage Ordinance, as codified in Chapter 2, Division6, Section 2-407 thru 2-410 of the Miami Beach Code, all service contractors, entering into a contract with the city shall pay to all its employees, a living wage of not less than $8.56 an hour with health benefits, or a living wage of not less than $9.81 an hour without health benefits. For a covered employer to company with the living wage provision by choosing to pay the lower wage scale ($8.56/hour) when a covered employer also provides health benefits, such health benefits shall consist of payment of at least $1.25 per hour toward the provision of health benefits for covered employees and their dependents. Detailed representation of all these ordinances can be found on the City of Miami Beach website at hfto://www.miamibeachfl.aovinewcitv/deptsiburchaseibidintra.aso Sincerely, ./ Gus Lopez, CPPO Procurement Director August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 3 of 43 MIAMI BEACH City of Miami Beach, 1700 Convention Center Drive, Miami Beach, Florida 33139, www.rnicmibeachf.gov PROCUREMENT DIVISION Tel: 305-673-7490; Fox: 786,394,4006 NO BID NOTICE TO PROSPECTIVE BIDDERS ITB #47-06/07 If not submitting a bid at this time, please detach this sheet from the bid documents, complete the information requested, and return to the address listed above. NO BID SUBMITTED FOR REASON(S) CHECKED AND/OR INDICATED: _Our company does not handle this type of product/service. _We cannot meet the specifications nor provide an alternate equal product. _Our company is simply not interested in bidding at this time. OTHER. (Please specify) We do do not want to be retained on your mailing list for future bids for the type or product and/or service. Signature: Title: Company: Note: Failure to respond, either by submitting a bid or this completed form, may result in your company being removed from the City's bid list. August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 4 of 43 VIDEO MONITORING EQUIPMENT BID # 47-06/07 1.0 GENERAL CONDITIONS 1.1 SEALED BIDS: Original copy of Bid submission, as well as any other pertinent documents must be returned in order for the bid to be considered for award. All bids are subject to the conditions specified hereon and on the attached Special Conditions, Specifications and Bid Form. The completed bid plus three (3) copies must be submitted in a sealed envelope clearly marked with the Bid Title to the City of Miami Beach Procurement Division, 3rd floor, 1700 Convention Center Drive, Miami Beach, Florida 33139. Facsimile or e-mailed bids will not be accepted. 1.2 EXECUTION OF BID: Bid must contain a manual signature of an authorized representative in the space provided on the Bid Form. Failure to properly sign bid shall invalidate same and it shall NOT be considered for award. All bids must be completed in pen and ink or typewritten. No erasures are permitted. If a correction is necessary, draw a single line through the entered figure and enter the corrected figure above it. Corrections must be initialed by the person signing the bid. Any illegible entries, pencil bids or corrections not initialed will not be tabulated. The original bid conditions and specifications CANNOT be changed or altered in any way. Altered bids will not be considered. Clarification of bid submitted shall be in letter form, signed by Bidders and attached to the bid. 1.3 NO BID: If not submitting a bid, respond by returning the enclosed bid form questionnaire, and explain the reason. Repeated failure to bid without sufficient justification shall be cause for removal of a supplier's name from the bid mailing list. 1.4 PRICES QUOTED: Deduct any applicable trade discounts and quote firm net prices. Give both unit price and extended total, when requested. Prices must be stated in units of quantity specified in the bidding specifications. In case of discrepancy in computing the amount of the bid, the UNIT PRICE quoted will govern. All prices must be F.O.B. destination, freight prepaid (unless otherwise stated in special conditions). Any discounts for prompt payment should be specified. Award, if made, will be in accordance with terms and conditions stated herein. Cash or quantity discounts offered will not be a consideration in determination of award of bid(s). 1.5 TAXES: The City of Miami Beach is exempt from all Federal Excise and State taxes. State Sales Tax and Use Certificate Number is 85-8012621639C-9. 1.6 MISTAKES: Bidders are expected to examine the specifications, delivery schedules, bid prices and extensions and all instructions pertaining to supplies and services. Failure to do so will be at the Bidder's risk. August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 5 of 43 1.7 CONDITION AND PACKAGING: It is understood and agreed that any item offered or shipped as a result of this bid shall be the latest new and current model offered (most current production model at the time of this bid). All containers shall be suitable for storage or shipment, and all prices shall include standard commercial packaging. 1.8 UNLABORATORIES: Unless otherwise stipulated in the bid, all manufactured items and fabricated assemblies shall be U.L. listed or re-examination listing where such has been established by U.L. for the item(s) offered and furnished. 1.9 BIDDER'S CONDITIONS: The CdvConlnisakonneaenxemtheright tmxva�e irregularities ortechnk�� technicalities 'e�all bids, Prany part ofany bid, they deem necessary for the best interest of the City of Miami Beach, Florida. 1.10 EQUIVALENTS: |fbidder offers makes ofequipment orbrands ofsupplies other than those speoifimdinthe foUowinQ, he must so indicate on his bid. Specific article(s) ofequipnnenVoupp|iea shall conform in quality, design and construction with all published claims of the manufacturer, and shall to be approved by the City's Parking Department, or a City designee. Brand Names: Catalog numnbens, manufacturers' and brand names, when |imted, are informational guides as to a standard of acceptable product quality level only and should not be construed as an endorsement or a product limitation of recognized and legitimate manufacturers. Bidders shall formally substantiate and verify that product(s) offered conform with or exceed quality as Iisted in the specifications. Bidder shall indicate on the bid form the manufacturer's name and number if bidding other than the specified brands, and shall indicate ANY deviation from the specifications as listed. Other than specified items offered requires complete descriptive technical literature marked to indicate detail(s) conformance with specifications and MUST BE INCLUDED WITH THE BID. NO BIDS WILL BE CONSIDERED WITHOUT THIS DATA. Lacking any written indication of intent to quote an alternate brand or model number, the bid will be considered as a bid in complete compliance with the specifications as Iisted on the attached form. NON-CONFORMANCE TO CONTRACT CONDITIONS: Items may be tested for compliance with specifications. Item delivered, not conforming to specifications may be rejectedmndreturnodsdvendo/uexpenea. These items and items not delivered as per delivery date in bid and/or purchase order may be purchased on the open market. Any increase in cost may be charged against the Bidder. Any violation of these stipulations may also result in: A) Vendor's name being removed from the vendor Iist. B) All departments being advised not to do business with vendor, 1.12 SAMPLES: Samples of items, when required, must be furnished free of expense and, if not destroyed, wili, upon request, be returned at the Bidder's expense. Bidders will be responsible for the removal of all samples furnished within (30) days after bid opening. All samples will be August 27, 2007 City of Miami Beach ITB No: 47-06/0 Video Monitoring Equipment 6w^a disposed of after thirty (30) days. Each individual sample must be labeled with Bidder's name. Failure of Bidder to either deliver required samples or to clearly identify samples may be reason for rejection of the bid. Unless otherwise indicated, samples should be delivered to the Procurement Division, 1700 Convention Center Drive, Miami Beach, FL 33139. 1.13 DELIVERY: Unless actual date of delivery is specified (or if specified delivery cannot be met), show number of days (in calendar days) required to make delivery after receipt of purchase order, in space provided. Delivery time may become a basis for making an award. Delivery shall be within the normal working hours of the user, Monday through Friday, excluding holidays, unless otherwise required. 1.14 INTERPRETATIONS: Unless otherwise stated in the bid, any questions conceming conditions and specifications should be submitted in writing to the Procurement Coordinator, 1700 Convention Center Drive, Miami Beach, FL 33139; E-mail PamelaLeianmiamibeachfl.aov; Fax (786) 394-4006. 1.15 BID OPENING: Bids shall be opened on the date, time and place specified in this Bid document. All bids received after the date, time, and place shall be returned, unopened. 1.16 INSPECTION, ACCEPTANCE & TITLE: Inspection and acceptance will be at destination unless otherwise provided. Title to/or risk of loss or damage to all items shall be the responsibility of the successful Bidder until acceptance by the buyer unless loss or damage result from negligence by the buyer. If the materials or services supplied to the City are found to be defective or not conform to specifications, the City reserves the right to cancel the order upon written notice to the seller and return product at Bidder's expense. 1.17 PAYMENT: Payment will be made by the City after the items awarded to a vendor have been received, or services provided, inspected, and found to comply with award specifications, free of damage or defect and properly invoiced. Invoices must include the purchase order number. 1.18 DISPUTES: In case of any doubt or difference of opinion as to the items to be furnished hereunder, the decision of the City shall be final and binding on both parties. L19 LEGAL REQUIREMENTS: Federal, State, county and city laws, ordinances, rules and regulations that in any manner affect the items covered herein apply. Lack of knowledge by the Bidder will in no way be a cause for relief from responsibility. 1.20 PATENTS & ROYALTIES: The Bidder, without exception, shall indemnify and save harmless the City of Miami Beach, Florida and its employees from liability of any nature or kind, including cost and expenses for, or on account of, any copyrighted, patented, or unpatented invention, process, or article manufactured or used in the performance of the contract, including its use by The City of Miami Beach, Florida. If the Bidder uses any design, device or materials covered by letters, patent, or copyright, it is mutually understood and agreed, without exception, that the bid prices shall include all royalties or cost arising from the use of such design, device, or materials in any way involved in the work. August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 7 of 43 1.21 OSHA: The Bidder warrants that the product supplied to the Cho of Miami Beach, Florida shall conform in all respects to the standards set forth in the Occupational Safety and Health Act of 1970, as amended, and the failure to comply with this condition will be considered as a breach of contract. Any fines levied because of inadequacies to comply with these requirements shall be borne solely by the Bidder responsible for same. 1.22 SPECIAL CONDITIONS: Any and all Special Conditions that may vary from these General Conditions shall have precedence. 1.23 ANTI -DISCRIMINATION: The Bidder certifies that he/she is in compliance with the non-discrimination clause contained in Section 202, Executive Order 11246, as amended by Executive Order 11375, relative to equal employment opportunity for all persons without regard to race, oo|or, religion, sex or national origin. 1.24 AMERICAN WITH DISABILITIES ACT: To request this material in accessible formot, sign language intmrpretero, information on access for persons with disabilities, and/or any accommodation to review any document or participate in any city -sponsored proceeding, please contact 305'604-2489 (voice), 305- 673-7524 (fax) or 305-673-7218 (TTY) five days in advance to initiate your request. TTY users may also calI 711 (Florida Relay Service). 1.25 QUALITY: All materials used for the manufacture or construction of any supplies, materials or equipment covered by this bid shall be new. The items bid must be new, the Iatest model, of the best quality, and highest grade workmanship. 1.26 LIABILITY, INSURANCE, LICENSES AND PERMITS: Where Bidders are required to enter or go onto City of Miami Beach property to deliver materials or perform work or services as a result of a bid award, the successful Bidder will assume the full duty, obligation and expense of obtaining all necessary Ucenooa, permits and insurance and assure all work complies with all applicable Miami -Dade County and City of Miami Beach municipal code requirements as well as the Florida Building Code. The Bidder shall be liable for any damages or loss to the City occasioned by negligence of the Bidder (or agent) or any person the Bidder has designated in the completion of the contract mem result of his or her bid. 1.27 BID GUARANTY: N/A 1.28 DEFAULT: Failure or refusal of a Bidder to execute a contract or fulfill a purchase order upon award, or withdrawal of a bid before such award is made, may result in forfeiture of that portion of any bid surety required equal to liquidated damages incurred by the City thereby, or where surety is not required, failure to execute a contract as described above may be grounds for removing the Bidder from the Bidder's Iist. 1.29 CANCELLATION: In the event any of the provisions of this bid are violated by the contractor, the Procurement Director shall give written notice to the contractor stating the deficiencies and unless deficiencies are corrected within ten (10) days, recommendation will be made to the City Commission for immediate cancellation. The City Commission of Miami Bmooh. Florida August 27, 2007 City of Miami Beach !TB No: 47*6/07 Video Monitoring Equipment 8 of 43 reserves the right to terminate any purchase order or contract resulting from this invitation at any time and for any reason, upon giving thirty (30) days prior written notice to the other party. 1.30 BILLING INSTRUCTIONS: Invoices, unless otherwise indicated, must show purchase order numbers, and shall be submitted to the City of Miami Beach, Parking Department, 309 23 Street, Suite 200, Miami Beach, Florida, 33139; with a copy to the Accounts Payable Department, 1700 Convention Center Drive, Miami Beach, Florida 33139. 1.31 NOTE TO VENDORS DELIVERING TO THE CITY OF MIAMI BEACH: Receiving hours are Monday through Friday, excluding holidays, from 8:30 A.M. to 5:00 P.M., unless otherwise indicated. The Parking Department is to be notified a minimum of one (1) business day prior to delivery. 1.32 SUBSTITUTIONS: The City will not accept substitute shipments of any kind without prior written approval from the City. Bidder(s) is expected to furnish the brand quoted in their bid once awarded, oras designated on the City's purchase order. Any non -authorized substitute shipments will be returned at the Bidder's expense. 1.33 FACILITIES: The City reserves the right to inspect the Bidder's facilities at any time with prior notice. 1.34 BID TABULATIONS: Bidders desiring a copy of the bid tabulation may request same by enclosing a self- addressed stamped envelope with the bid. 1.35 BID PROTEST PROCEDURES Bidders that are not selected may protest any recommendation for Contract award in accordance with City of Miami Beach Ordinance No. 2002-3344, which establishes procedures for resulting protested bids and proposed awards. Protest not timely pursuant to the requirements of Ordinance No. 2002-3344 shall be barred. 1.36 CLARIFICATION AND ADDENDA TO BID SPECIFICATIONS: If any person contemplating submitting a Bid under this Solicitation is in doubt as to the true meaning of the specifications or other Bid documents or any part thereof, the Bidder must submit to the City of Miami Beach Procurement Division at least ten (10) calendar days prior to scheduled Bid opening, a request for clarification. All such requests for clarification must be made in writing and the person submitting the request will be responsible for its timely delivery. Any interpretation of the Bid, if made, will be made only by Addendum duly issued by the City of Miami Beach Procurement Division. The City shall issue an Informational Addendum if clarification or minimal changes are required. The City shall issue a Formal Addendum if substantial changes which impact the technical submission of Bids are required. A copy of such Addendum shall be sent by RFP Depot via e-mail or facsimile to each Bidder receiving the Solicitation that is a subscriber to the RFP Depot notification system. Bidders who are not subscribers to the RFP Depot system are responsible for ensuring that they have received all addenda. In the event of conflict with the original Contract Documents, Addendum shall govern all other Contract Documents to the extent specified. Subsequent addendum shall govern over prior addendum only to the extent specified. The Bidder shall be required to acknowledge receipt of the Formal Addendum by signing in the space provided on the Bid Form. Failure to acknowledge Addendum shall deem its Bid non- responsive; provided, however, that the City may waive this requirement in its best interest. August 27, 2007 ITB No: 47-06/07 City of Miami Beach Video Monitoring Equipment 9of43 The City will not be responsible for any otheor interpretation made verbaily or in writing by any other City representative. 1.37 DEMONSTRATION OF COMPETENCY: 1) Pre -award inspection of the Bidder's facility may be made prior to the award of contract. Bids will only be considered from firms which are regularly engaged in the business of providing the goods and/or services as described in this Bid. Bidders must be able to demonstrate a good record of performance for a reasonable period of time, and have sufficient financial support, equipment and organization to insure that they can satisfactorily execute the services if awarded a contract under the terms and conditions herein stated. The terms "equipment and organization" as used herein shall be construed to mean a fully equipped and well established company in line with the best business practices in the industry and as determined by the City of Miami Beach. 2) The City may consider any evidence available regarding the financial, technical and other qualifications and abilities of a Bidder, including past performance (experience) with the City in making the award in the best interest of the City. 3) The City may require Bidders to show proof that they have been designated as authorized representatives of a manufacturer or supplier which is the actual source of supply. In these instances, the City may also require material information from the source of supply regarding the quality, packaging, and characteristics of the products to be supplies to the City through the designated representative. Any conflicts between this material information provided by the source of supply and the information contained in the Bidder'a Proposal may render the Bid non-responsive. 4) The City may, during the period that the Contraor Purchase Order between the City and the successful Bidder is in force, review the successful Bidder's record of performance to insure that the Bidder is continuing to provide sufficient financial support, equipment and organization as prescribed in this Solicitation. Irrespective of the Bidder's performance on contracts awarded to it by the City, the City may place said contracts on probationary status and implement termination procedures if the City determines that the successful Bidder no longer possesses the financial support, equipment and organization which would have been necessary during the Bid evaluation period in order to comply with this demonstration of competency section. 1.38 DETERMINATION OF AWARD The City Commission shall award the contract to the lowest and best Bidder. In determining the lowest and best Bidder, in addition to price, there shall be considered the following: a. The ability, capacity and skill of the Bidder to perform the Contract. b. Whether the Bidder can perform the Contract within the time specified, without delay or interference. c. The character, integrity, reputation, judgment,enperienceandeMiciencyofthe Bidder. d. The quality of performance of previous contracts. e. The previous and existing compliance by the Bidder with laws and ordinances relating to the Contract. August 27, 2007 City of Miami Beach ITB No: 47-m6/07 Video Monitoring Equipment 1001e 1.39 ASSIGNMENT: The contractor shall not assign, transfer, convey, sublet or otherwise dispose of this contract, including any or all of its right, title or interest therein, or his or its power to execute such contract to any person, company or corporation without prior written consent of the City of Miami Beach. 1.40 LAWS, PERMITS AND REGULATIONS: The Bidder shall obtain and pay for all licenses, permits and inspection fees required for this project; and shall comply with all laws, ordinances, regulations and building code requirements applicable to the work contemplated herein. 1.41 SPOT MARKET PURCHASES: It is the intent of the City to purchase the items specifically listed in this bid from the awarded vendor. However, items that are to be a Spot Market Purchased may be purchased by other methods, i.e. Federal, State or local contracts. 1.42 ELIMINATION FROM CONSIDERATION This bid solicitation shall not be awarded to any person or firm which is in arrears to the City upon any debt, taxes or contracts which are defaulted as surety or otherwise upon any obligation to the City. 1.43 WAIVER OF INFORMALITIES The City reserves the right to waive any informalities or irregularities in this bid solicitation. 1.44 ESTIMATED QUANTITIES Estimated quantities or estimated dollars, if provided, are for City guidance only. No guarantee is expressed or implied as to quantities or dollars that will be used during the contract period. The City is not obligated to place any order for a given amount subsequent to the award of this bid solicitation. Estimates are based upon the City's actual needs and/or usage during a previous contract period. The City for purposes of determining the low Bidder meeting specifications may use said estimates. 1.45 COLLUSION Bids from related parties. Where two (2) or more related parties each submit a bid or proposal for any contract, such bids or proposals shall be presumed to be collusive. The foregoing presumption may be rebutted by presentation of evidence as to the extent of ownership, control and management of such related parties in the preparation and submittal of such bids or proposals. Related parties mean Bidders or proposers or the principals thereof which have a direct or indirect ownership interest in another Bidder or proposer for the same contract or in which a parent company or the principals thereof of one (1) Bidder or proposer have a direct or indirect ownership interest in another Bidder or proposer for the same contract. Bids or proposals found to be collusive shall be rejected. Bidders or Proposers who have been found to have engaged in collusion may be considered non - responsible, and may be suspended or debarred, and any contract resulting from collusive bidding may be terminated for default. 1.46 DISPUTES In the event of a conflict between the documents, the order of priority of the documents shall be as follows: • Any agreement resulting from the award of this Bid (if applicable); then August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 11 of43 • Addenda released for this Bid, with the latest Addendum taking then • The Bid; then • Awardee's Bid. 1.47 REASONABLE ACCOMMODATION In accordance with the Title II of the Americans with Disabilities Act, any person requiring an accommodation at the Bid opening because of a disability must contact the ADA Compliance Coordinator, at the Public Works Department at (305) 673-7080. 1.48 GRATUITIES Proposers shall not offer any gratuities, favors, or anything of monetary value to any official, employee, or agent of the City, for the purpose of influencing consideration of this proposal. 1.49 SIGNED BID CONSIDERED AN OFFER The signed bid shall be considered an offer on the part of the Bidder or contractor, which offer shail be deemed accepted upon approval by the City Commission of the City of Miami Beach, Florida and in case of default on the part of successful Bidder or contractor, after such acceptance, the City may procure the items or services from other sources and hold the Bidder or contractor responsible for any excess cost occasioned or incurred thereby. 1.50 BID CLARIFICATION: Any questions or clarifications concernithis Invitation to Bid shati be submitted in writing by mail or facsimile to the Procurement Department, 1700 Convention Center Drive, Miami Beach, Florida, 33139 via e-mail: PameIaLeia(miamibeachfl.qav, or via fax: (786) 394- 4006. The bid title/number shall be referenced on all correspondence. All questions must be received no later than ten (10) calendar days prior to the scheduled bid opening date. All responses to questions/clarifications will be sent to all prospective bidders in the form of an addendum. NO QUESTIONS WILL BE RECEIVED VERBALLY OR AFTER SAID DEADLINE. 1J51 TIE BIDS: Please be advised that in accordance with Florida Statues Section 287.087, regarding identical tie bids, preference will be given to vendors certifying that they have implemented a drug free work place program. A certification form will be required at the time of Bid submission. 1.52 PUBLIC ENTITY CRIMES (PEC): Aperson oraffiliate who has been placed on the convicted vendor list following a convictio for public entity crimes may not submit a bid on a contract to provide any goods or services to a public entity, may not submit a bid on a contract with a public entity for the construction or repair of a public building or public work, may not submit bids on leases of real property to public entity, may not be awarded or perform work as a contnmotor, nupp|ier, oub- oontractor, or consultant under a contract with a public entity , and may not transact business with any public entity in excess of the threshold amount provided in Sec. 287.017, for CATEGORY TWO for a period of 36 months from the date of being placed on the convicted vendor Iist. 1.53 DETERMINATION OF RESPONSIVENESS: Determination of responsiveness will take place at the time of bid opening and evaluation. In order to be deemed a responsive Bidder, your bid must conform in all material respects to August 27, 2007 City of Miami Beach ITB No: 47-06/0 Video MonitoriEquipment 12of*» the requirements stated in their Bid. 1.54 DELIVERY TIME: Bidders shall specify on the attached Bid Form, the guaranteed delivery time (in calendar days) for each item. It must be a firm delivery time, no ranges will be accepted, i.e.; 12-14 days. 1.55 CONE OF SILENCE This invitation to bid is subject to the "Cone of Silence" in accordance with Ordinance No. 2002-3378. A copy of all written communication(s) regarding this bid must be filed with the city clerk. 1.56 EQUAL BENEFITS FOR DOMESTIC PARTNERS Proposers are advised that this RFP and any contract awarded pursuant to this procurement process shall be subject to the applicable provisions of Ordinance No. 2005- 3494, entitled "Requirement for City Contractors to Provide Equal Benefits for Domestic Partners (the "Ordinance")." The Ordinance applies to all employees of a Contractor who work within the City limits of the City of Miami Beach, Florida; and the Contractor's employees located in the United States, but outside of the City of Miami Beach limits, who are directly performing work on the contract within the City of Miami Beach. All proposers shall complete and return, with their proposal, the "Declaration: Non- discrimination in Contracts and Benefits" form contained herein. The City shall not enter into any contract unless the proposer certifies that such firm does not discriminate in the provision of Benefits between employees with Domestic Partners and employees with spouses and/or between the Domestic Partners and spouses of such employees. Contractors may also comply with the Ordinance by providing an employee with the Cash Equivalent of such Benefit or Benefits, if the City Manager or his designee determines that: a. The Contractor shall complete and return the "Reasonable Measures Application" contained herein, and the Cash Equivalent proposed; AND. b. The Contractor shall complete and return the "Substantial Compliance Authorization Form" contained herein. It is important to note that Contractors are considered in compliance if Contractor provides benefits neither to employees' spouses nor to employees' Domestic Partners. 1.57 TERMINATION FOR DEFAULT If through any cause within the reasonable control of the successful Bidder, it shall fail to fulfill in a timely manner, or otherwise violate any of the covenants, agreements, or stipulations material to the Agreement, the City shall thereupon have the right to terminate the services then remaining to be performed by giving written notice to the successful Bidder of such termination which shall become effective upon receipt by the successful Bidder of the written termination notice. In that event, the City shall compensate the successful Bidder in accordance with the Agreement for all services performed by the Bidder prior to termination, net of any costs incurred by the City as a consequence of the default. August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 13of43 Notwithstanding the above, the successful Bidder shall not be relieved of liability to the City for damages sustained by the City by virtue of any breach of the Agreement by the Bidder, and the City may reasonably withhold payments to the successful Bidder for the purposes of set off until such time as the exact amount of damages due the City from the successful Bidder is determined. 1.58 TERMINATION FOR CONVENIENCE OF CITY The City may, for its convenience, terminate the services then remaining to be performed at any time without cause by giving written notice to successful Bidder of such termination, which shall become effective thirty (30) days following receipt by Bidder of such notice. In that event, all finished or unfinished documents and other materials shall be properly delivered to the City. If the Agreement is terminated by the City as provided in this section, the City shall compensate the successful Bidder in accordance with the Agreement for all services actually performed by the successful Bidder and reasonable direct costs of successful Bidder for assembling and delivering to City all documents. No compensation shall be due to the successful Bidder for any profits that the successful Bidder expected to earn on the balanced of the Agreement. Such payments shall be the total extent of the City's liability to the successful Bidder upon a termination as provided for in this section. 1.59 INSURANCE AND INDEMNIFICATION: The contractor shall be responsible for his work and every part thereof, and for all materials, tools, appliances and property of every description, used in connection with this particular project. He shall specifically and distinctly assume, and does so assume, all risks of damage or injury to property or persons used or employed on or in connection with the work and of all damage or injury to any person or property wherever located, resulting from any action or operation under the contract or in connection with the work. It is understood and agreed that at all times the contractor is acting as an independent contractor. The contractor, at all times during the full duration of work under this contract, including extra work in connection with this project shall meet the following requirements: Maintain Worker's Compensation and Employer's Liability Insurance to meet the statutory requirements of the State of Florida. Maintain Comprehensive General Liability Insurance in amounts prescribed by the City (see checklist for limits) to protect the contractor in the interest of the City against all risks of injury to persons (including death) or damage to property wherever located resulting from any action or operation under the contract or in connection with the work. This policy is to provide coverage for premises/operations, independent contractor, broad form property damage, products/completed operations and contractual liability. Maintain Automobile Liability Insurance including Property Damage covering all owned, non -owned or hired automobiles and equipment used in connection with the work. Maintain any additional coverages required by the Risk Manager as indicated on the Insurance Check List. Name the City of Miami Beach as an additional insured on all liability policies required by this contract. When naming the City of Miami Beach as an additional insured onto your policies, the insurance companies hereby agree and will endorse the policies to state that the City will not be liable for the payment of any premiums or assessments. A copy of the endorsement(s) naming the City of Miami Beach as an additional insured is required and must be submitted to the City's Risk Manager. August 27, 2007 ITB No: 47-06/07 City of Miami Beach Video Monitoring Equipment 14of43 No change or cancellation in insurance shall be made without thirty (30) days written notice to the City of Miami Beach Risk Manager. All insurance policies shall be issued by companies authorized to do business under the laws of the State of Florida and these companies must have a rating of at least B+:VI or better per Best's Key Rating Guide, latest edition. Original signed Certificates of Insurance, evidencing such coverages and endorsements as required herein, shall be filed with and approved by the City of Miami Beach Risk Manager before work is started. The certificate must state Bid Number and Title. Upon expiration of the required insurance, the contractor must submit updated certificates of insurance for as long a period as any work is still in progress. It is understood and agreed that all policies of insurance provided by the contractor are primary coverage to any insurance or self-insurance the City of Miami Beach possesses that may apply to a loss resulting from the work performed in this contract. All policies issued to cover the insurance requirements herein shall provide full coverage from the first dollar of exposure. No deductibles will be allowed in any policies issued on this contract unless specific safeguards have been established to assure an adequate fund for payment of deductibles by the insured and approved by the City's Risk Manager. The liability insurance coverage shall extend to and include the following contractual indemnity and hold harmless agreement: "The contractor hereby agrees to indemnify and hold harmless the City of Miami Beach, a municipal corporation, its officers, agents, and employees from all claims for bodily injuries to the public in and up to the amount of $1,000,000.00 for each occurrence and and for all damages to the property of others in and up to the amount of $1,000,000.00 for each occurrence per the insurance requirement under the specifications including costs of investigation, all expenses of litigation, including reasonable attorney fees and the cost of appeals arising out of any such claims or suits because of any and all acts of omission or commission of any by the contractor, his agents, servants, or employees, or through the mere existence of the project under contract". The foregoing indemnity agreement shall apply to any and all claims and suits other than claims and suits arising out of the sole and exclusive negligence of the City of Miami Beach, its officers, agents, and employees, as determined by a court of competent jurisdiction. The contractor will notify his insurance agent without delay of the existence of the Hold Harmless Agreement contained within this contract, and furnish a copy of the Hold Harmless Agreement to the insurance agent and carrier. The contractor will obtain and maintain contractual liability insurance in adequate limits for the sole purpose of protecting the City of Miami Beach under the Hold Harmless Agreement from any and all claims arising out of this contractual operation. The contractor will secure and maintain policies of subcontractors. All policies shall be made available to the City upon demand. Compliance by the contractor and all subcontractors with the foregoing requirements as to carrying insurance and furnishing copies of the insurance policies shall not relieve the contractor and all subcontractors of their liabilities and obligations under any Section or Provisions of this contract. Contractor shall be as fully responsible to the City for the acts and omissions of the subcontractor and of persons employed by them as he is for acts and August 27, 2007 ITB No: 47-06/07 City of Miami Beach Video Monitoring Equipment 15of43 omissions of persons directly employed by him. Insurance coverage required in these specifications shall be in force throughout the contract term. Should any awardee fail to provide acceptable evidence of current insurance within seven days of receipt of written notice at any time during the contract term, the City shall have the right to consider the contract breached and justifying the termination thereof. If bidder does not meet the insurance requirements of the specifications; alternate insurance coverage, satisfactory to the Risk Manager, may be considered. It is understood and agreed that the inclusion of more than one insured under these policies shall not restrict the coverage provided by these policies for one insured hereunder with respect to a liability claim or suit by another insured hereunder or an employee of such other insured and that with respecttoc|oirnoaga\nmt any insured hereunder, other insureds hereunder shafl be considered members of the public; but the provisions of this Cross Liability clause shall apply only with respect to liability arising out of the ownership, maintenance, use, occupancy or repair of such portions of the premises insured hereunder as are not reserved for the exclusive use of occupancy of the insured against whom claim is made or suit is filed. August 27, 2007 City of Miami Beach noNo: 47-06/07 ITB No. 47-06/07 Video Monitoring Equipment for City Garages INSURANCE CHECK LIST XXX 1. Workers' Compensation and Employer's Liability per the Statutory limits of the state of Florida. XXX 2. Comprehensive General Liability (occurrence form), limits of liability $ 1.000.000.00 per occurrence for bodily injury property damage to include Premises/ Operations; Products, Completed Operations and Contractual Liability. Contractual Liability and Contractual Indemnity (Hold harmless endorsement exactly as written in "insurance requirements" of specifications). XXX 3. Automobile Liability - $1,000,000 each occurrence - owned/non-owned/hired automobiles included. 4. Excess Liability - $ .00 per occurrence to follow the primary coverages. XXX 5. The City must be named as and additional insured on the liability policies; and it must be stated on the certificate. 6. Other Insurance as indicated: Builders Risk completed value $ .00 Liquor Liability $ .00 Fire Legal Liability $ .00 Protection and Indemnity $ .00 Employee Dishonesty Bond $ .00 Other XXX 7. Thirty (30) days written cancellation notice required. XXX 8. Best's guide rating B+:VI or better, latest edition. XXX 9. The certificate must state the bid number and title BIDDER AND INSURANCE AGENT STATEMENT: We understand the Insurance Requirements of these specifications and that evidence of this insurance may be required within five (5) days after bid opening. Bidder Signature of Bidder August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 17 of 43 VIDEO MONITORING EQUIPMENT BID # 47-06/07 2.0 SPECIAL CONDITIONS 2.1 PURPOSE: The purpose of this ITB is to establish a contract, by means of seaed bids, to a qualified contractor for the purchase and installation of video monitoring equipment in City garages. 2.2 TERM OF CONTRACT: This contract shall remain in effect for a period of two (2) years from date of contract execution by the Mayor and City Clerk, and may be renewed at the sole discretion of the City, for three (3) additional one (1) year terms, providing the successful bidder will agree to maintain the same terms and conditions of the current contract. At time of renewal each year, the City may negotiate an adjustment to price based on Consumer Price Index increase. Change shati not be more than the percentage increase or decrease in the Consumer Price Index CPI -U (all urban areas) computed 60 days prior to the anniversary date of the contract. Change shall not be more than the percentage increase or decrease in the Consumer Price Index CPI -U (all urban areas) computed 60 days prior to the anniversary date of the contract. 2.3 METHOD OF AWARD: Award of this contract may be made to the primary and secondary lowest and best Bidders, as defined in General Conditions 1.38, whose bid will be most advantageous to the City of Miami Beach. Should the primary vendor fail to comply with the Terms and Conditions of this Contract, the City reserves the right to award to the secondary vendor, if it is deemed to be in the best interest of the City. 2.4 PAYMENT: lnvoicesfor paymentwill be submitted after successful delivery,, insand accepting by the City, and determination of compliance to the specifications. lnvoices will be subject to verification and approval by the Parking Department. 2.5 PRICES SHALL BE FIXED AND FIRM FOR TERM OF CONTRACT: If the Bidder is awarded a contract under this bid soicitatiom, the prices quoted by the Bidder on the Bid Form shall remain fixed and firm during the term of this contract; provided, however, that the Bidder may offer incentive discounts from this finedprice tothe City otany time during the contractual term. The City is also interested in receiving bids that include flexible pricing terms that provide the City with maximum options and flexibility as regulatory and marketplace changes take place. 2.6 SHIPPING TERMS: Pnces shall inctude freight to City's premises, and shall be F.O.B. Destination. Vendor shall hold title to the goods until such time as they are delivered to, and accepted by, an authorized City representative. August 27, 2007 City of Miami Beach n8No: 47-06/07 2.7 PRE-BID CONFERENCE: A Pre-bid conference will be held on September 6, 2007 at 10:00 a.m. in the City Manager's Large Conference Room, Fourth Floor, City Hall, 1700 Convention Center Drive, Miami Beach, Florida 33139. Attendance (in person or via telephone) to this Pre-bid meeting is encouraged and recommended as a source of information, but is not mandatory. Bidders interested in participating in the pre-bid submission meeting via telephone must follow these steps: (1) Dial the TELEPHONE NUMBER: 1-800-915-8704 (Toll-free North America) (2) Enter the MEETING NUMBER: *2659980* (note that number is preceded and followed by the star (*) key). Bidders who are interested in participating via telephone, please send an e-mail to PamelaLeja@miamibeachfl.gov expressing your intent to participate via telephone at least one business day in advance of the meeting. 2.8 VENDOR APPLICATION The City of Miami Beach is utilizing RFP Depot, as an electronic procurement service for automatic notification bid notification opportunities and document fulfillment. RFP Depot allows for vendors to register online and receive notification of new bids, amendments and awards. Vendors with Internet access should review the registration options at the following website: www.rfodeoot.com If you do not have Internet access, please contact the RFP Depot's vendor support group at 800-990-9339 or 801-765-9245. 2.9 CONTACT PERSON: The contact person for this Invitation to Bid is Pamela Leja. The contact person may be reached by phone: 305.673.7490; fax: 786.394.4006; or e-mail: PamelaLeiaemiamibeachfl.00v. Communications between a proposer, Bidder, lobbyist or consultant and Procurement Staff are limited to matters of process or procedure. Requests for additional information or clarifications must be made in writing to the contact person, with a copy to the City Clerk, no later than ten (10) calendar days prior to the scheduled Bid opening date. The City will issue replies to inquiries and any other corrections or amendments it deems necessary in written addenda issued prior to the deadline for responding to the Bid. Bidders should not rely on representations, statements, or explanations other than those made in this Bid or in any written addendum to this Bid. Bidders should verify with the Procurement Division prior to submitting a proposal that all addenda have been received. YOU MUST FAMILIARIZE YOURSELF WITH GENERAL CONDITION 1.55, ENTITLED CONE OF SILENCE, WHICH SETS FORTH THE POLICIES AND PROCEDURES RELATIVE TO ORAL AND WRITTEN COMMUNICATIONS. 2.10 SAMPLES Samples of items, when required, must be furnished free of expense and, if not destroyed, will, upon request, be returned at the Bidder's expense. Bidders will be responsible for the August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 19 of 43 removal of all samples furnished within (30) days after bid opening. All samples will be disposed of after thirty (30) days. Each individual sample must be Iabeled with Bidder's name. Failure of Bidder to either deliver required samples or to clearly identify samples may be reason for rejectionofUlobid.Un|esoothemineindicoted.aann9|esahou|dboda|iwemad to the Procurement Division, 1700 Convention Center Drive, Miami Baach, FL 33139. 2.11 DELIVERY TIME: Delivery date will be confirmed at time of placing Purchase Order(s) hovvevmr, in no way shall the delivery date be a longer period of time than the delivery date specified on the Bidder's bid form. 2.12 LIQUIDATED DAMAGES: Failure to complete work orders within the specified time may result in the successful Bidder being assessed the additional cost incurred by the City (liquidated damages) for any and all costs associated with the service performed by a secondary vendor. 2.13 PERCENTAGE ABOVE VENDOR COST/ DISCOUNTS (From published price lists): Bids for parts and supplies not listed in the bid documents shall be submitted at a percentage above vendor cost discount from a manufacturer's published price Iist(s). Evidence of said costs shall be submitted with invoice, for each repair or service call. Proof of costs shall be printed, properly identified, and dated as to issuance and effectiveness. Published price list(s) must be common to, and accepted by, the industry in general. The lists must be printed, properly |dentified, and dated as to issuance and effectiveness. Revised published prices list(s) may be used as a means of price adjustments. Hoxvever, all bids are to be firm for a period of 365 calendar days after the bid opening date and revised price list(s) will not be accepted by the City until after that date. Revised published price list(s) will be accepted only in the event of an industry -wide price chmnge, as evidenced by the issuance of revised pnce Iists by the manufacturer. Revised pnces will not become effective until revised list(s) are submitted to the City under the vendor cover letter identifying the applicable bid number. Vendor cover letter and pricing list(s) must be dated, signed and submitted to the Procurement Director. 2.14 ESTIMATED QUANTITIES: Quantities, if stated, are for Bidders' guidance only and no guarantee is given or implied as to quantities that will be used dunng the contract period. Estimated quantities are based upon previous needs. Said estimated quantities may be used by the City for the purpose of evaluating the low Bidder meeting specifications. 2.15 HOURLY RATE: |fapplicable, Bidders are requested to provide regular and overtime hourly labor rates in the bid proposal form. The hourly rate quoted shall include full compensation for labor, equipment use, travel time, and any other cost to the bidder. 2.16 WARRANTY: The successful Bidder will be required to warranty all work performed and equipment supplied for a period of not less than one year. Option(s) for extended warranty may also August 27, 2007 City of Miami Beach ITB No: w-06107 Video Monitoring Equipment 20 of 43 be bid. 2.17 PRODUCT/CATALOGUNFORMAT8ON: Upon request, Bidders muand/or samples on the product(s) they propose to furnish on this bid. The City, after evaluation of the documentation submitted (specs and/or samples), will determine if product is approved as equal to specified. 2.18 REFERENCES (PROVIDE �0EFEpKE�W��E��,U��T��EC:��STK�U�E�0F�EFE�KE��E FORM) Each bid nnust � auoonmponiedbvarninimumofeix(6)werifiab|mrefenances.offirnoor government organizations for which the contractor is currently furnishing, or has furnished similar type, size and complexity of work or equipment as specified herein. Reference shall include the name of the company, a contact person, contact person's E-MAIL ADDRESS, , the telephone number and facsimile number. A BID MAY NOT BE CONSIDERED WITHOUT THIS COMPLETE LIST. 2.19 COMPLETE PROJECT REQUIRED: These specifications describe the equipment to be supplied and delivered The scope of these specifications is to insure the delivery of complete units, ready for operation. Failure to list any items or classes under scope of the several sections shall not relieve the contractor from furniah|ng, installing or performing such work where required by any part of these specifications, or necessary to the satisfactory completion of the pjact. 2'20 FACILITY LOCATION: Delivery is to be FOB to the City of Miami Beach. 2.21 BIDDER QUALIFICATIONS: In order for bids to be considered, Bidders must submit with their bid, evidence that they are qualified to satisfactonly perfomi the specifiedified service. Evidence shall include all information necessary to certify that the Bidder: maintains a permanent place of business; has not had ustorproper o|mi ) pending against himnorhis firm; and has provided simni|artype, size and ' complexity ofsuch work. The evidence will consist of listing of contracts for similar materials that have been provided to public and private sector clients, within the last three (3) years. 2.22 LATE BIDS: At time, date, and place noted herein, bids will be opened. Any bids or proposals received after time and date specified will be returned to the Bidder unopened. The responsibilityfor submitting a bid/proposal before the stated time and date is solely and strictly the responsibility of the Bidder/proposer. The City is not responsible for delays caused by mail, courier service, including U.S. Mail, or any other occurrence. 2.23 EXCEPTIONS TO SPECIFICATIONS: Exceptions to the specifications shall attached to the Bid Form and shall reference the section. Any exceptions to the General or Special Conditions shall be cause for the bid to be considered non-responsive. Bidders are strongly encouraged to thoroughly review the system and/or experience and qualification requirements set forth in this Bid, specifically the scope of services sections that are identified by the words "must", "shall", and "will". Bidders who fail to satisfy the requirements set forth, may be deemed non-responsive and receive no further consideration. Should your Bid submission not be able to meet one (1) or more of the requirements set forth in this Bid and you are proposing alternatives to said requirements, you must notify the Procurement office in writing at least five days prior to the August 27, 2007 ITB No: 47o6m7 City of Miami Beach Video Monhtonng Equipment 21m*u deadline for submission of Bids. The City reserves the right to revise the scope of services via addendum prior to the deadline for receipt of Bids. 2.24 COMPLETE INFORMATION REQUIRED ON BID FORM: To be considered a valid bid, the ORIGINAL AND THREE (3) COPIES of the Bid package with all required submittal information must be returned, properly completed, in a sealed envelope as outlined in the first paragraph of General Conditions. 2.25 MAINTENANCE AGREEMENT: If applicable, is to be included, per Scope of Service and Deliverable requirements, as outlined in this ITB. 2.26 EQUAL PRODUCT: Manufacturer's name, brand name and model number are used in these specifications for the purpose of establishing minimum requirement of level of quality, standards of performance and design required, and is not intended to prohibit the bidding of other manufacturer's items of equal material, unless otherwise indicated. Equal product may be bid, provided product so bid is found to be equal in quality, standards of performance, design, etc. to item specified, unless otherwise indicated. Where equal is proposed, bid must be accompanied by complete factory information sheets (specifications, brochures, etc.) and test results of unit bid as equal, and shall to be approved by the City's Parking Department Assistant Director, or his designee. 2.27 CUSTOMER SERVICE: Excellent customer service is the standard of the City of Miami Beach. As contract employees of the City, all employees will be required to adhere to the City's "Service Excellence" standards and expected to conduct themselves in a professional, courteous and ethical manner in all situations. The successful Bidder's employees must work as a cooperative team of well-trained professionals, and must serve the public with dignity and respect. All business transactions with the City will be conducted with honesty, integrity, and dedication. August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 22 of 43 VIDEO MONITORING EQUIPMENT BID # 47-06/07 3.0 SCOPE OF SERVICES GENERAL ELECTRONIC SECURITY REQUIREMENTS The work specified in this bid consists of furnishing all labor, machinery, tools, means of transportation, supplies, equipment, materials, and services necessary, to include permits, to furnish and install video monitoring equipment in the City's garages listed as follows: 7th Street Parking Garage 12th Street Parking Garage 13th Street Parking Garage 1691 Street Parking Garage (Anchor Garage) 42nd Street Parking Garage Attached to this Bid is a .pdf file of the conceptual drawings of the above listed garages and and equipment locations. These conceptual drawings for this work are diagrammatic, intended to convey the extent, general arrangement and locations of the required work. Because of the scale of the drawings, certain basic items such as conduit fittings, access panels, cabinet sizes, sleeves, pull boxes, black boxes and junction boxes may not be shown. Bidder's are to Include all items where required by code, other sections, and for proper installation of the work. A CAD version of these drawings on a CD, that may be modified for the purpose of responding to this Bid, is available at the City of Miami Beach Procurement Division, City Hall, 3rd Floor, 1700 Convention Center Drive, for a fee of $10.00. All bidders are to provide their own version of the drawings, signed and sealed by an Engineer 3.1 STIPULATIONS A. The term "Contractor" shall apply to the installation contractor for the specification sections and project drawings. B. The Contractor shall be licensed by the State of Florida as an Electrical Contractor to install all related devices and systems utilized in this project specifically pipe and wire. 3.2 BASIC DESIGN SPECIFICATION REQUIREMENTS A. This section includes basic design requirements specifications for the integrated security management system. Requirements for submittals, quality assurance, product handling, record documents, project conditions, installation demonstrations and training. B. Security Reference Symbols: 1. Symbols used on the drawings are defined in the security symbols schedule of the drawings. Some of the symbols scheduled may not be required for the project symbols. 2. Because of the scale of the drawings, symbols are shown on drawings as close as possible to the mounting location. Verify exact locations with the City. August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 23 of 43 C. The Contractor shall provide the labor, materials, equipment, appHances, services and transportobon, and perform operations in connection with the construction and installation of all equipment. The Contractor shall be responsible for securing all necessary permits in connection with performing and completing scope of work specified herein. 3.3 REFERENCES AND COMPLIANCES TO THE LATEST EDITIONS, AS RELATED: A. National Electric Code (NEC). B. National Fire Protection Agency (NFPA). C. Underwriters Laboratories (U L). D. Amencans with Disability Act (ADA). E. Uniform Building Code (UBC). F. Federal Communications Commission (FCC). G. National Burglar Alarm and Fire Alarm Association. H. Closed Circuit Television Manufacturers Association 3.4 SYSTEM DESCRIPTION A. Design Requirements: 1) Drawings for this work are conceptual and diagrammatic, intended to convey the extent, general arrangement and locations of the required work. Because of the scale of the drawingo, certain basic items such as conduit fittings, access panels, cabinet sizes, sleeves, pull boxes, black boxes and junction boxes may not be shown. Include all items where required by code, other sections, and for proper installation of the work. 2) All splices not terminating at a terminal strip shall be joined with solder and electrical tape utilizing methods indicated in NEC 2002, or by Scotch Lok IDC connectors. 3) Security conductors shall be minimum #18AWG unless otherwise noted. Size conductors in accordance with the equipment manufacturer's recommendations, and NEC to ensure proper operation and alarm notifications. 4) All security shall be routed through conduit or concealed cable tray provided and installed by Contractor, unless otherwise indtcated. Alt devices will be provided with appropriate electrical back boxes, and conduit raceway. Alt raceways shall be a minimum 3/4 inches unless otherwise noted. Size raceways and install conductors in accordance with the NEC and NFPA and Division 16 requirements. a. EMT conduit with compression fittings b. Rigid metal conduit shall be used in exposed exterior applications 5) Any and all conduit/raceway required by Contractor for a complete and operating system that is not shown on the project drawings shall bathe responsibility of the Contractor. 6) The Contractor shall supply and install all wire and cable for a complete and operational system. 7) Any etectrical raceway required by the Contractor beyond what is shown on the drawings shall be factored into the project bid price and shall bathe responsibility of the Contractor. August 27, 2007 City of Miami Beach ITB No: 47-06/0r 8) Outdoor enclosures shall be NEMA 4 rated. 3.5 SUBMITTALS A. Submittal review is considered as general acceptance of the basic applicability of the equipment. Contractor is responsible for the installation of the equipment and/or alternate arrangement of the equipment within a given space. B. All materials and equipment the Contractor proposes to furnish shall be submitted to the Architect/Engineer for review and shall comply with the requirements of Submittals. Data shall be complete in all respects and shall reference, where applicable, to the unit symbol utilized on the Drawings and Specifications. Partial or incomplete submittals are not acceptable. C. Contractor further agrees that if deviations, discrepancies or conflicts between shop drawings and the Specifications are discovered either prior to or after shop drawing submittals are processed by the Engineer, the design Drawings and Specifications shall control and be followed. Review of submittal data shall in no way relieve the Contractor of his duty to perform all work and provide all equipment in strict compliance with the requirements set forth on the drawings herein. D. The Contractor shall submit detailed shop drawings for approval of all equipment to be constructed and installed. Such drawings shall be complete, giving all required information, and shall be properly checked and coordinated with the work of other trades before submission. No work shall be performed until application shop drawings and layout drawings have been approved by the City. E. The Contractor shall submit shop drawings to include dimensions, wiring and block diagrams, conduit sizes, performance data, ratings, control sequences, and all other descriptive data necessary to describe the item proposed and its operating characteristics. F. The Contractor shall submit complete technical data necessary to evaluate the material and equipment. Include a complete technical specification for the submitted equipment, noting differences and adherence to this section. G. Prior to substantial completion, provide `project record' schematic drawings depicting location of interface, number of conductors, and types of connectors, circuit requirements and type of enclosure. 3.6 QUALITY ASSURANCE A. Contractor shall have no less than 5 years of documented work experience on projects of equivalent size and scope. "Experience" is defined as the completion of an operational security management/control system, with the system being successfully operated by the Contractor's client for its intended purpose for at least one year. B. Equipment specifications may not deal individually with every part, control, or device, which may be required to produce the equipment performance specified or as required August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 25 of 43 to meet the equipment warranties. Contractor is to include such items, as required, for a complete operational ovetenn, whether or not specifically indicated. C. If installation of equipment, oacfxwoyo, cable trays and/or conduit interferes with the work of other trades, the Contractor shall make necessary changes to correct the condition at no adthtional cost to the City. D. Regulatory Requirements: 1. National Electric Code (NEC) 2. National Fire Protection Association (NFPA) 3. Underwriters Laboratories (UL) 4. Americans with Disabilities Act (ADA) 5. Uniform building code (UBC) 6. Regulations of the: a. Federal Government b. State ofFlorida c. City of Miami Beach 3.7 PRODUCT DELIVERY, STORAGE AND HANDLING a. Contractor shall protect materials stored on the job site, during construohon, and after installation. Contractor shall provide protection of equipment until time of substantial completion b. Contractor shall provide and apply protective materiaupon receiving the products and maintain throughout the instaHation process. c. Contractor shall keep products clean and dry, elevating equipment above ground and floor. d. Contractor shall take precautions to protect apparatus and materials from damage e. Failure to protect materials constitutes sufficient cause for rejection of the apparatus or material. f Contractor shall protect factory finish from damage during installation operations and until final acceptance. Restore finished that become otoined, aoedchad, or damaged. 3.8 DOCUMENTS Contractor shall provide complete schematic drawings depicting the location of in1erface, number of conductors, type of connectors, circuit requirements and type of enclosure. 3.9 PRODUCT CONDITIONS Contractor shall protect active services, water, gas, sevver, and e|enthc, when encountered, against damage. If active services are encountered which require relocation, notify the City promptly in writing. August 27, 2007 City of Miami Beach ITB No: 47-06/07 3.10 MATERIALS 1. Raceway — Comply with drawings provided 2. Provide identification for wiring systems and equipment. 3. Color code junction boxes and enclosures per NEC. Color for security circuits is to be white. 4. Lettering for identification: Sign painters' quality or stencil lettering, using fast drying sign enamel. 5. Identify security equipment panels, system interface cabinets, and similar equipment with 1/2 -inch red lettering. Letter flush panels inside the door to cover. 6.. Engraved laminated plastic tags may be used for identification in lieu of painted lettering. 7. As a minimum of the component/wire label shall meet the following criteria: a. The label shall be made of polyvinyl fluoride material. (Design Basis: Panduit GMT1 Series). b. Self adhesive c. Self Laminating. d. The printable surface shall be white in color for ease of legibility. e. Text shall be minimum of 8 pt bold type, and black in color for ease of legibility. 8. All conductors/cables shall be bundled per NEC and secured by the following method: a. Conductors/ cables bundled and secured using single weather resistant nylon cable ties of sufficient length, on a minimum of 12 inch centers. b. Cable ties shall be of one piece construction — up to 250 lbs. minimum loop tensile strength. c. Cable ties shall be installed by the use of a hand operated, "tool controlled" tension and cut off cable tie installation tool. (Design Basis: Panduit GS Series) 9. Cable ties shall be secured to the security equipment enclosures by the use of screw mount devices. The cable tie mounting device shall not be of adhesive mount construction unless manufactured in combination with the screw mount device. 3.11 INSTALLATION A. Contractor shall provide tamper resistant installation utilizing security fastening devices. B. Contractor shall repair or replace any defective or damaged equipment as required to provide complete and fully operational systems. System is to be retested as necessary and ensure proper operation of system(s). 3.12 QUALITY CONTROL TESTING 1. Contractor shall notify City's representative in writing, in advance of testing. 2. Contractor shall test all systems and place in proper and specified working order prior to demonstration of the system. 3. Contractor shall test system grounds to demonstrate that the ground resistance does not exceed the requirements of the transient voltage surge suppression (TVSS) or exceed the National Electric Code (NEC). 4. Contractor shall perform tests, as required, by authorities having jurisdiction over the site. 5. Testing shall be in the presence of the City's designated representatives, and representatives of the authorities having jurisdiction, all subsystems, features and functions of the system, and shall instruct the City in the proper operation and event August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 27 of 43 sequences of the system. 3.13 INSPECTIONS AND ACCEPTANCE At the completion of the project and prior to final acceptance of the work, Contractor shall provide evidence of final inspections and approvals to the City. 3.14 VIDEO EQUIPMENT The system requires a fully operational multi-camera/monitor microprocessor—based, color closed circuit television system. Design requirements include system expandability to accommodate the addition of multiple cameras and increased coverage areas, incorporation of date/time/title for each connected camera. Closed circuit television equipment aliows for the monitoring/viewing of remote areas from one or more controlled stations. Contractor shall provide new digital video recording capability for all new cameras as specified in this bid. Digital recording minimum storage capacity shall be of 3 terabytes per DVR. The Contractor shall be responsible for visiting the sites prior to bid the submission date to be familiar with the existing site conditions. 3'15 WARRANTY A. Warranty period shall be for one year, commencing from the date of final acceptance. Contractor may also submit a bid for an extended warranty. B. Contractor shall agree to repair or replace defective components/materials and to correct defective work when given notice during the warranty period, at no cost to the City. C. Warranty response time is to be within eight (8) hours upon Contractor's receipt of notiflcation by the City, during normal working hours. 3'16 EXTRA MATERIALS PER SITE Contractor shall provide the City with: 1. One (1) camera housing for each type utilized on the project as spare. 2. One (1) power supply for each type utilized on the project as spares. 3. Two (2) camera for each type utilized on the project as spares. 4. Two (2) Ienses for each type utilized on the projectject as spares. 5. Written procedures for obtaining return authorizations (If not required, state so in writing). 3.17 PRQDUCTS (See Section 2.26 "EQUAL PRODUCTS") GE Security GEC-EVR1 Color, Hi0h-R(000\udon.54OTVL.Digital C)SD.24\A\C GE Security KTL-2.5-1O\AA 2.5-1Ornrn.f1.4Vorhocai DC Auto Iris Lens August 27, 2007 City of Miami Beach ITB No: 47-06/0 Video Monitoring Equipment 28 of 43 GE Security GBC-PI-950-P5 GE Security CM -1500 -LP -S GE Security KTE-100 GE Security KTP -24-16-200 GE Security Sym Dec16+4-3T GE Security Sym Dec 16+4 -RK Extreme CCTV REG -L1 Patented Extreme CCTV REG -D1 Integrated Extreme CCTV REG -M1 August 27, 2007 City of Miami Beach PIR Camera (functional PIR), Color 1/3" CCD, 380 TVL, 3 lux, 5mm Pinhole lens Corner -mount High Resolution Color, 2.5, 4, and 6mm Lens pack, 10 40VDC/18-30VAC, Brushed Stainless Indoor/Outdoor housing with mount Indoor Power Supply, 16 fused 24 VAC Outputs, 200VA Sym Dec 16 plus 4, 3 TB Hybrid Recorder Sym Dec 16 plus, Rack Mount Kit License Plate Capture Camera Overview Camera Mobile Design End of Section ITB No: 47-06/07 Video Monitoring Equipment 29 of 43 PAYMENT TERMS: NET 30. If other, specify here ANY LETTERS, ATTACHMENTS, OR ADDITIONAL INFORMATION TO BE CONSIDERED PART OF THE BID MUST BE SUBMITTED AS ORIGINAL AND THREE (3) COPIES. SUBMITTED BY: COMPANY NAME: SIGNED: (1 certify that I am authorized to execute this bid and commit the bidding firm) Bidders must acknowledge receipt of addendum (if applicable). Addendum No. 1: Addendum No, 2: Insert Date Addendum No. 3: Addendum No. 4: Insert Date NAME/TITLE(Print): ADDRESS: City/STATE: TELEPHONE NO: E-MAIL: FACSIMILE NO: FEDERAL I.D.#: August 27, 2007 City of Miami Beach ZIP: Insert Date Insert Date ITB No: 47-06/07 Video Monitoring Equipment 30 of 43 CUSTOMER REFERENCE LISTING Bidder's shall furnish the names, addresses, and telephone numbers, E-MAIL addresses. and fax number of a minimum of six (6) private or public organizations for which the Bidder is currently furnishing or has furnished, similar type, size and complexity of equipment as specified herein. All references must be valid and verifiable. 1) Company Name Address Contact Person/Contract Amount Telephone No. E-mail 2) Company Name Address Contact Person/Contract Amount Telephone No. E-mail 3) Company Name Address Contact Person/Contract Amount Telephone No. E-mail August 27, 2007 City of Miami Beach Fax No. Fax No. Fax No. ITB No: 47-06/07 Video Monitoring Equipment 31 of 43 CUSTOMER REFERENCE LISTING (CONTD.) 4) Company Name Address Contact Person/Contract Amount Telephone No. E-mail 5) Company Name Address Contact Person/Contract Amount Telephone No. E-mail 6) Company Name Address Contact Person/Contract Amount Telephone No. E-mail August 27, 2007 City of Miami Beach Fax No. Fax No. Fax No. ITB No: 47-06/07 Video Monitoring Equipment 32 of 43 DECLARATION: NONDISCRIMINATION IN CONTRACTS AND BENEFITS Section 1. Vendor Information Phone Number: Fax Number: E-mail: Vendor Number (if known): Federal ID or Social Security Number: Approximate Number of Employees in the U.S.: (If 50 or Tess, skip to Section 4, sign and date) Are any of your employees covered by a collective bargaining agreement or union trust fund? Yes No Union name(s): Section 2. Compliance Questions Question 1. Nondiscrimination - Protected Classes A. Does your company agree to not discriminate against your employees, applicants for employment, employees of the City, or members of the public on the basis of the fact or perception of a person's membership in the categories listed below? Please note: a "YES" answer means your company agrees it will not discriminate; a "NO" answer means your company refuses to agree that it will not discriminate. Please answer yes or no to each category. Race _ Yes _ No Sex _Yes _ No Color _ Yes _ No Sexual orientation_ Yes _ No Creed _ Yes _ No Gender identity (transgender status) _ Yes _ No Religion _ Yes _ No Domestic partner status _ Yes _ No National origin _ Yes _ No Marital status_ Yes _ No Ancestry_ Yes _ No Disability _ Yes _ No Age_ Yes _ No AIDS/HIV status _ Yes _ No Height _ Yes _ No Weight _ Yes _ No B. Does your company agree to insert a similar nondiscrimination provision in any subcontract you enter into for the performance of a substantial portion of the contract you have with the City? Please note: you must answer this question, even if you do not intend to enter into any subcontracts. _Yes_No August 27, 2007 ITB No: 47-06/07 City of Miami Beach Video Monitoring Equipment Question 2. Nondisorimination - Equal Benefits for Employees with Spouses and Employees with Domestic Partne !Questions 2Aand 28should be answered YES even if yos must pay some o,all nfthe co�u,spousal ordnmemicpa�ne,bene�»a. | A. Does your company provide or offer access to any benefits to employees with spouses or to spouses of employees? _ Yes _No B. Does your company provide or offer access to any benefits to employees with (same or opposite sex) domestic partners* or to domestic partners of employees? Yes No *The term DomestiPartner shall mean any two (2) adultof the same or different sex, who have registered as domestic partners with a govemment body pursuant to state or local |a* authorizing such regkmratino, or with an internal registry maintained by the employer of at least one of the domestic partners. A Contractor may institute an intemal registry to allow for the provision of equal benefits to employees with domestic partner who do not register their partnerships pursuant to a governmental body authorizing such registration, or who are located in a jurisdiction where no such governmental domestic partnership exists. A Contractor that institutes such registry shall not impose criteria for registration that are more stringent than those required for domestic partnership registratiori by the City of Miami Beach If vou answered "NO" to both Questions 2A and 2B, go to Section 4 (at the bottom of this page), complete and sign the form, filling in all items requested. If vou answered "YES" to either or both Questions 2A and 2B, please continue to Question 2C below. C. Pleascheck all benefits that apply to your answers above and Iist in the "other" section any additional benefits not already specified. Note: some benefits are provided to employees because they have a spouse or domestic partner, such as bereavement leave; other benefits are provided directly to the spouse or domestic partner, such as medical insurance. Yes for Yes for Employees No, this Documentation of this Employees with with Domestic Benefit is Not Benefit is Submitted Spouses Partners Offered with this Form o o o u 0 o o o o n o o o BENEFIT Health Dental Vision Retirement (Pension, 401(k), etc Bereavement Family Leave Parental Leave Employee Assistance Program Relocation & Travel Company Discount, Facilities & Events Credit Union Child Care Other n n o o o o o o o o o o o o o o o 0 0 o O 0 o 0 u o n o O o o 0 o 0 o 0 Note: If you can not offer a benefit in a nondiscriminatory manner because of reasons August 27, 2007 ITB No: 47-06/0 outside your control, (e.g., there are no insurance providers in your area willing to offer domestic partner coverage) you may be eligible for Reasonable Measures compliance. To comply on this basis, you must agree to pay a cash equivalent, submit a completed Reasonable Measures Application with all necessary attachments, and have your application approved by the City Manager, or his designee. Section 3. Required Documentation YOU MUST SUBMIT SUPPORTING DOCUMENTATION to verify each benefit marked in Question 2C. Without proper documentation, your company cannot be certified as complying with the City's Equal Benefits Requirement for Domestic Partner Ordinance. For example, to document medical insurance submit a statement from your insurance provider or a copy of the eligibility section of your plan document; to document leave programs, submit a copy of your company's employee handbook. If documentation for a particular benefit does not exist, attach an explanation. Have you submitted supporting documentation for each benefit offered? Section 4. Executing the Document _Yes _ No I declare under penalty of perjury under the laws of the State of Florida that the foregoing is true and correct, and that I am authorized to bind this entity contractually. Executed this day of , in the year , at Signature Name of Signatory (please print) Title City Mailing Address City, State, Zip Code State August 27, 2007 ITB No: 47-06/07 City Of Miami Beach Video Monitoring Equipment CITY OF MIAMI BEACH REASONABLE MEASURES APPLICATION Declaration: Nondiscrimination in Contracts and Benefits Submit this form and supporting documentation to the City's Procurement Division ONLY IF you: a. Have taken aU reasonable measures to end discrimination in benefits;and b. Are unable to do so; and c. Intend to offer a cash equivalent to employees for whom equal benefits are not available. You must submit the foflowing information with this form: 1. The names, contact persons and telephone numbers of benefits providers contacted for the purpose of acquiring nondiscriminatory benefits; 2. The dates on which such benefits providers were contacted; 3. Copies of any wntten response(s) you received from such benefits providers, and if written responses are unavaitable, summaries of orat responses; and 4. Any other information you feel is relevant to documenting your inability to end discrimination in benefite, inc|uding, but not limited to, reference to federal or state laws which preclude the ending of discrimination in benefits, 1 declare (or certify) under penalty of perjury under the laws of the State of Florida that the foregoing is true and comact, and that 1 am authorized to bind this entity contractually. Name of Company (please print) Mailing Address of Company Signature City, State, Zip Name of Sprint) Telephone Number Title Date August 27, 2007 ITB No: 47-06m City Of Miami Beach Video Monitoilng Equipment Definition of Terms A. REASONABLE MEASURES The City of Miami Beach will determine whether a City Contractor has taken all reasonable measures provided by the City Contractor that demonstrates that it is not possible for the City Contractor to end discrimination in benefits. A determination that it is not possible for the City Contractor to end discrimination in benefits shall be based upon a consideration of such factors as: (1) The number of benefits providers identified and contacted, in writing, by the City Contractor, and written documentation from these providers that they will not provide equal benefits; (2) The existence of benefits providers willing to offer equal benefits to the City Contractor; and (3) The existence of federal or state laws which preclude the City Contractor from ending discrimination in benefits. B. CASH EQUIVALENT "Cash Equivalent" means the amount of money paid to an employee with a Domestic Partner (or spouse, if applicable) in lieu of providing Benefits to the employees' Domestic partner (or spouse, if applicable). The Cash Equivalent is equal to the employer's direct expense of providing Benefits to an employee for his or her spouse. Cash Equivalent. The cash equivalent of the following benefits apply: a. For bereavement leave, cash payment for the number of days that would be allowed as paid time off for death of a spouse. Cash payment would be in the form of wages of the domestic partner employee for the number of days allowed. b. For health benefits, the cost to the Contractor of the Contractor's share of the single monthly premiums that are being paid for the domestic partner employee, to be paid on a regular basis while the domestic partner employee maintains the such insurance in force for himself or herself. c. For family medical leave, cash payments for the number of days that would be allowed as time off for an employee to care for a spouse that has a serious health condition. Cash payment would be in the form of wages of the domestic partner employee for the number of days allowed. August 27, 2007 ITB No: 47-06/07 City Of Miami Beach Video Monitoring Equipment CITY OF MIAMI BEACH SUBSTANTIAL COMPLIANCE AUTHORIZATION FORM Declaration: Nondiscrimination in Contracts and Benefits This form, and supporting documentation, must be submitted to the Procurement Division by entities seeking to contract with the City of Miami Beach that wish to delay ending their discrimination in benefits pursuant to the Rules of Procedure, as set out below. Fill out all sections that apply. Attach additional sheets as necessary. A. Open Enrollment Ending discrimination in benefits may be delayed until the first effective date after the first open enrollment process following the date the contract with the City begins, provided that the City Contractor submits to the Procurement Division evidence that reasonable efforts are being undertaken to end discrimination in benefits. This delay may not exceed two years from the date the contract with the City is entered into, and only applies to benefits for which an open enrollment process is applicable. Date next benefits plan year begins: Date nondiscriminatory benefits will be available: Reason for Delay: Description of efforts being undertaken to end discrimination in benefits: August 27, 2007 ITB No: 47-06/07 City Of Miami Beach Video Monitoring Equipment B. Administrative Actions and Reauest for Extension Ending discrimination in benefits may be delayed to allow administrative steps to be taken to incorporate nondiscriminatory benefits into the City Contractor's infrastructure. The time allotted for these administrative steps shall apply only to those benefits for which administrative steps are necessary and may not exceed three months. An extension of this time may be granted at the discretion of the Procurement Director, upon the written request of the City Contractor. Administrative steps may include, but are not limited to, such actions as computer systems modifications, personnel policy revisions, and the development and distribution of employee communications. Description of administrative steps and dates to be achieved: If requesting extension beyond three months, please explain basis: C. Collective Baraainina Agreements (CBA) Ending discrimination in benefits may be delayed until the expiration of a City Contractor's Current collective bargaining agreement(s) where all of the following conditions have been met: 1. The provision of benefits is governed by one or more collective bargaining agreement(s); 2. The City Contractor takes all reasonable measures to end discrimination in benefits either by requesting that the Unions involved agree to reopen the agreements in order for the City Contractor to take whatever steps necessary to end discrimination in benefits or by ending discrimination in benefits without reopening the collective bargaining agreements; and 3. In the event that the City Contractor cannot end discrimination in benefits despite taking all reasonable measures to do so, the City Contractor provides a cash equivalent to eligible employees for whom benefits are not available. Unless otherwise authorized in writing by the Procurement Director, this cash equivalent payment must begin at the time the Unions refuse to allow the collective bargaining August 27, 2007 ITB No: 47-06/07 City Of Miami Beach Video Monitoring Equipment agreements to be reopened, or in any case no longer than three (3) months from the date the contract with the City is entered into. For a delay to be granted under this provision, written proof must be submitted with this form that: The benefits for which the delay is requested are governed by a collective bargaining agreement; All reasonable measures have been taken to end discrimination in benefits (see Section C.2, above); and A cash equivalent payment will be provided to eligible employees for whom benefits are not available. I declare (or certify) under penalty of perjury under the laws of the State of Florida that the foregoing is true and correct, and that I am authorized to bind this entity contractually. Name of Company (please print) Mailing Address of Company City, State, Zip Signature Name of Signatory (please print) Telephone Number Title Date August 27, 2007 ITB No: 47-06/07 City Of Miami Beach Video Monitoring Equipment MIAMIBEACH City of Miami Beach, 1700 Convention Center Drive, Miami Beach, Florida 33139. www.miamibeochfl.gov PROCUREMENT DIVISION Tel: 305.673.7490 , Fax: 786.394.4006 Date: To: Name of firm and contact filling out survey Phone: Fax: E-mail: Subject: Performance Evaluation of Number of pages including cover: 2 To Whom It May Concern: The City of Miami Beach has implemented a process that collects past performance information on vendors that provide, install and support integrated system solutions. The information will be used to assist City of Miami Beach in the procurement of such services. The company listed in the subject line has chosen to participate in this program. They have listed you as a past client for which they have provided services. Both the company and City of Miami Beach would greatly appreciate you taking a few minutes of your time to complete the accompanying questionnaire. Please review all items in the following document and answer the questions to the best of your knowledge. If you cannot answer a particular question, please leave it blank. Please return this questionnaire to Pamela Leja by Tuesday, September 25, 2007, via fax: 786.304.4006; or e-mail PamelaLeiaCmiamibeachfi.gov Thank you for your time and effort. Gus Lopez, CPPO Procurement Director August 27, 2007 ITB No: 47-06/07 City Of Miami Beach Video Monitoring Equipment m MIAMIBEACH City of Miami Beach, 1700 Convention Center Drive, Miami Beach, Florida 33139, n,wh.miorn beech;l.gc.v PROCUREMENT DIVISION Tel: 305.673.7490 , Fax: 786.394.4006 PERFORMANCE EVALUATION SURVEY Name of Company Being Evaluated Point of Contact: Phone and e-mail: Please evaluate the performance of the Contractor/Vendor (10 means you are very satisfied and have no issues with utilizing their services again; 5 is don't know; and 1 is if you would never utilize their services again due to very poor performance). 1 2 3 CRITERIA Ability to manage cost Ability to meet committed installation time Maintenance and support 4 Professionalism and ability to manage project implementation 5 Level of communication and complete documentation 6 Ability to follow requirements Overall customer satisfaction and hiring again based on performance (comfort level in hiring contractor again) OverallComments: Contact Reference Business Name: Contact Name: Contact Phone and e-mail: Date of Services Estimated Dollar Amount for Services: RATING August 27, 2007 ITB No: 47-06/07 City Of Miami Beach Video Monitoring Equipment ITB No. 47-05/06 PURCHASE AND INSTALLATION OF VIDEO MONITORING EQUIPMENT BID FORM Bid shall include all applicable permit fees 1) 7th Street Parking Garage No. of Days to Start of Installation (ARO) No. of Days from Start to Completion of 2) 12th Street Parking Garage No. of Days to Start of Installation (ARO) No. of Days from Start to Completion of 3) 13th Street Parking Garage No. of Days to Start of Installation (ARO) No. of Days from Start to Completion of 4) 16th Street Parking Garage No. of Days to Start of Installation (ARO) No. of Days from Start to Completion of 5) 42nd Street Parking Garage No.of Days to Start of Installation (ARO) No. of Days from Start to Completion of Warranty include —Must be a Minimum of one (1) year (provide details) Extended Warranty Cost $ (provide details) $ $ $ $ $ August 27, 2007 ITB No: 47-06/07 City Of Miami Beach Video Monitoring Equipment '01311\0 03Xli V2INVO V21311V3 31100iNill 21311V3 •er I'd 11 Ui,i4t)J 1 ADM e-iJs ---------- ------ . • 1." 0 / 5/24/2007 t48 1 a 11,,,,IA*1 • ONANWAW•WANAWA/A.WAIIIVARAWANNAINWOINNIV.O.I.I.PAOHJAI,........NALLWAIVAWAW.O.Arlll *±I V8314VO 03X1.1 Ve1311V3 Ve0VIV3 3110aINIVI V213103 dTd JN3tJ31 Alle11103S 0 .- 0 z ................. ........ • ... .. 5/24/2007 40 PM 4 5. 444421 onm 8F nil rn V2l3HHV3 2Jd1 V8311Y3 31100INIW V213WV3 4 41 ® W'," .__.... UNjJj I A1181 IJ4S r / C7 2 7.1 5/24/2007 148 FL ..r................, , ......... 11 . ; • 1 V831^1V3 03XIA v31^13 Vel3INV3 31100ININI V213103 'elTd m 1.4 7 4-1 , 5/24/2007 1:48 PM 1 1a �S Q xi t 45 `da3V V3 O]XJJ V213103 'a'd'1 ` d3110/0 31100INIW 41 tla3WV3 N m n 70 m m Z `s, 5/24/4007 I:48 FY 11H1 3I1V7 03x13 VM3VItl0 3WOOININI tl2I3HV3 '2f1'd g 17, 2 2 QI Ei 1 3 t V831^1V3 COXIJ V2131^1V3 t/1311,1V3 3VIOGININ V21314V3 w m r- 4 1 7 '1 1 A ....... ........ „ - - 4 . ----- --- -- ------ - I: ,, 5 i 1 V831WD "Wdi " ' • " ----- • • • 0) r- 0 6 mom we a: i/' 3 aoo-u lasi.1 • • • • A 11 ...... . ..... ........ • • • .. . . ...... ........... n ---------- • • • • • • 3 rr ; I I ; ................ • - • ...... • • ...„...... ..„_„ ..... _„ „. „ ' . ...... 9 rere.wwwervomern.reee.remere.oweeree.M...we, 5/24/2007 1:4B P41 • • f 4; IVO V21 V21311V3 3YIOOIN111 V8311V3 m C"7 r m c> m r O Z X m 4� 1 1 1 WAAWJAM00000MAWAWAHWAWAVAIVAIWWWWHAVAI,Wed,WAPAW,WAWM,,,,,WAIMPHee,,,,,,,,,,WAWAMWAMWAWAWAWIAIWANYVYWAWAPAWAWAWAWAJW/IVAN*Arej r":71LJrn L-. 5/24/2007 14B PM •• 4.•••••••••.,41...1,,,,,e0J. go:•.:14x 11.o0L2.111•1111 V2:13141V3 G3XIA Ve131.1VJ 'erd-1 V213V4V3 311001N111 Ve13161V3 '21Td g£,f• V40,./ARAPAROMPA.444. 5/24/2007 148 RJ 1 f Vel3INVO 03X13 Ve131A1V3 *ei'd'i a Vel3INVO 31NOCIINIIA1 .!) T.; CIN3031 AilemoJs ;s 3 5/24/2007 1:48 PM 1 nn5-0-E-co- VLI3INV3 03X13 :•424 44,:42 va3wv3 '21'cr1 V213101V0 3110GININI ---------- 314V3 'el'I'd U) rn 0 m0 41 ------- • 5/24/2007 1:48 PM r., V8311V0 CIAXIA V83WV3 '8'd'1 •r• ,,,, •.... V83kIV3 '8'I'd a N3031 Allan°3s H313>IS NOI1V301 ... „ ......:,...„,.........„1-11.':,:... II\ ".' ..,-..\:;.,.., ,...,,,,. 7....4.77.........,.. .: ,._.. A.0.0/XXXX.0.0, ggf G 5/24/2007 148 PM •1* '0,13VIVO 83X1i • • ........ „ -- ...... V131^1V3 Vel3VIVO JkOOINIY Vel3WVO (®) 01\0031 Ailan33s /eV, nee.,,,,Se.X.Ver•Xee.e.,....te~-enVeVoLee•rnete.efffeCerfeWf•WatesiSe.e 11 5/24/2007 148 PM V8311V3 COXIA ....... — ,, V213101V3 '6' (11 V2J311,03 Id 411 0 0 z0 -------- `el•WAYeeI•le/Weed•••••••./VV/I•effee•relee•reeee • S/2412007 148 Pt ...,,,,,,,,,,,r.:-M.,:t!!!!!!?.*:-:r•XV.,-,,x4e4,..W.4.:•:440"...., ......5±re.e.r.e.morr.w.404.5rmocrAer.ene.somorrAtezouwee..treAnwonwrrAreenverdvereereererrerenve.eArererer,,,,,,,,ro.r...werr.,.....ree,.........r.,,,,,,.........,,,,, e 4.c?; .....1.:.. 1 .1 , g A a a teN3INVO C13XIJ Vel3WV3 '661 NIN3INVO 3101001MA 21314V3 0 rn 0 rn iv 0 m MIAMIBEACH City of Miami Beach, 1700 Convention Center Drive, Miami Beach, Florida 33139, www.miarnibeachfl.gov PROCUREMENT DIVISION Tel: 305-673-7490 Fax: 786.394.4006 September 12, 2007 RE: ADDENDUM NO. 1 TO INVITATION TO BID (ITB) NO. 47-06/07 — FOR THE PURCHASE AND INSTALLATION OF VIDEO MONITORING EQUIPMENT FOR CITY GARAGES In response requests for additional information received by prospective Bidders by the Administration, the subject ITB is hereby amended as follows: 1) Prospective Bidders are encouraged to perform site visits to the garages. However, to ensure our staff and visitors are all on the same page, bidders are to check in at the parking facilities office with the Standard Parking (the City's 3nd party garage attendant firm) Supervisor on duty, who will log visitors in. This is for security reasons. 2) The drawings contained in the ITB are conceptual. and are to be used for the purpose of responding to this ITB. ONLY the successful bidderlsl. upon notice of award. must submit for Dermittina approval. their own version of drawings. sianed and certified by an enaineer. Sianed and certified drawinas ARE NOT required as Dart of the bid submission. CAD version of these drawings on a CD that may be modified for the purpose of responding to this Bid is available at the City of Miami Beach Procurement Division, City Hall, 3"d Floor, 1700 Convention Center Drive, for a fee of $10.00, to be paid with cash or check. 3) Section 2.26 entitled "EQUAL PRODUCT" is modified as follows: "Manufacturer's name, brand name and model number are used in these specifications for the purpose of establishing minimum requirement of level of quality, standards of performance and design required, and is not intended to prohibit the bidding of other manufacturer's items of equal material, unless otherwise indicated. Equal product may be bid, provided product so bid is found to be equal in quality, standards of performance, design, etc. to item specified, unless otherwise indicated. Where equal product/equipment is proposed, the bidder shall submit in writing their intent to supply an equal product or equipment, which must be accompanied by complete factory information sheets (specifications, brochures, etc.) and any test results of unit bid as equal. Prospective bidders must provide this information to the Procurement office in writina at least ten days prior to the deadline for submission of bids." 4) The due date for the receipt of bids has been changed to no later than 3:00 p.m. Eastern time on October 1, 2007. 5) The due date for receipt of questions and requests for approval of proposed equals, which must be in writing to PamelaLeiaemiamibeachfl.00v, or Fax to Pamela at 786.394.4006, is 4:00 p.m. Eastern time on Friday, September 21, 2007 6) The due date for Performance Evaluation Surveys to be submitted, via e-mail to, PamelaLeiaemiamibeachfi.aov, or via Fax to the attention of Pamela at 786.394.4006, is October 1, 2007. 7) The sign -in sheet from the pre -Bid meeting of September 6, 2007 is attached. ITB No 47-06/07 Addendum #1 September 12, 2007 Page 1 of 2 There are some questions that have been submitted by prospective bidders that are still under review and are pending response. The foliowing questions are being addressed in this Addendum: Question 1) Will you accept two bids, one as sand one with alternates, from the same company? Response 1) Yes. Question 2) Would the City of Miami Beach consider a 50Y6 initial payment of the total bid amourit to the selected vendor prior to commencement of the projectject reasonable? Response 2) The City does not make payments in advance of receipt of goods or services. The City may be acceptable to working out partial payment plan to compensate the selected vendor as work is completed, in phases. Another addendum will be published so as to respond to written questions received by the Administration. Bidders are reminded to please acknowledge receipt of this addendum as part of your bid submission. Potential bidders that have elected not to submit a response to the ITB are requested to complete and return the "Notice to Prospective Bidders" questionnaire with the reason(s) for not submitting a bid. CITY OF MIAMI BEACH Gus Lopez, CPPO Procurement Director ITB No 47-06/07 Addendum #1 September 12, 2007 Page 2 of 2 NiAMIBEAcH CITY OF MIAMI BEACH PRE-BID MEETING SIGN -IN SHEET DATE: September 6, 2007 ITB No.: 47-06/07 TITLE: VIDEO MONITORING EQUIPMENT FOR CITY GARAGES NAME (PLEASE PRINT) FL.AV I A . Tt %Aokon ,g4 NA' /-2-o0e, CPP 5TE✓9rq Zea COMPANY NAME - E-MAIL ADDRESS PHONE# FAX# 11.1-M6 12ATEi7.5EC u tet-rY SYS -0,S or to a a& 324% F5Cr l @ Icon/115S Om 6.32M-. gsco (lc . CS 1- (37, r\t- S‘-ky nuo,c4; ••(,, (Ai int\ cho &rib 305 4073?07/63.7-3 9 - C7� X5-3 C13Ps Om,• id/ A ,'s•e/-�6N Ft G-.e›L 1 / (,,/�/bJVw `,-J Sc. lr. '}, .. S � t C vVx-'t) Jysfc,LS , rv�.. VI -Cog 4/ovJ rnreS Ffia/ViraTle i=.roRe§2ooP, Com OS - 6 '7 S-05- cr s- -)4(- c rv/ c -Its! ,r1l3.. %!R -,z, p rl 51-167 1 .2nrc_ /5V/117 /Zoo ST v !d)41A-2 r tstd4tS yS raiyo i. c -O y� k IY� Yeti-it. jh imile/ st�.�'X�%' 7.0 8 77 �v 1� Lel { 1&/ ��s.40,r�' , t -am 122J .305 -&Ila Via MIAMIBEACH CITY OF MIAMI BEACH PRE-BID MEETING SIGN -IN SHEET DATE: September 6, 2007 ITB No.: 47-06/07 TITLE: VIDEO MONITORING EQUIPMENT FOR CITY GARAGES NAME (PLEASE PRINT) COMPANY NAME - E-MAIL ADDRESS A) 4-12_p_pou O7 04-151-01 0 1162 kr: 11 ilk/ 6TaPi-la &el, 094T, C PHONE# CAA 6 kt,c c)prenLf_Lig-z-rAokt,4-0,18-k%,r w X 7 1(9 cSr26 zZeg7-' (?Fto) 331-3?Dc/ 4fier S7794«= r ke, 6), c 1,197 1\f k)A-W?lAk Fil\k-t7Z141) 21MY D'E--6 I 120 GQ.Ba4, .Y\CL *C-cC Ek1i :IK( te S tee", (AG- re,citiwf ( 114 eerSteG• CAeis, — 73 b-fIP-i FAX# too4, y (71Q 331-3 ?en 7 F 6 - / 7 lop nro glA b 6 Z -O 3©c C.23 71 so 2) 67sy-strit-�' / Ee,G.hdced td-ofr 7e0, - 3 7 - 30sz, 5 (Q IVI nier2)49.e.5 c, com 3 S' 64-11 6PS11- -'1C-04/ (Stift /ha -real -cY-cr6&A -rrk, @sy)iiv? e sys7-615 Ytip m MIAMIBEACH CITY OF MIAMI BEACH PRE-BID MEETING SIGN -IN SHEET DATE: September 6, 2007 ITB No.: 47-06107 TITLE: VIDEO MONITORING EQUIPMENT FOR CITY GARAGES NAME (PLEASE PRINT) COMPANY NAME - E-MAIL ADDRESS PHONE# FAX# Toe is c/•rickg...a 6E -1-i2.6-49 Icy. 73 323,13 '133 -164 <'%0.6rvfi 61 & (e ,M.`ellita?5D35 ' elkc,✓,J,04(st a Te5c4- a 96. 31Weik 5EMa. ZSZJ.Ca Ci°5) 9z �—; ��"f- 763- 2 31 CJ 7 Ni. (Tim 13y% @ riezth Gam4h c6V1Z CITY OF MIAMI BEACH PRE-BID MEETING SIGN -IN SHEET DATE: September 6, 2007 ITB No.: 47-06107 TITLE: VIDEO MONITORING EQUIPMENT FOR CITY GARAGES NAME (PLEASE (PLEASE PRINT) 1 COMPANY NAME - E-MAIL ADDRESS PHONE# •P‘vv0 C -T1 t:)14 C-a- cAZEc•VT-14‘, 'k)Pe\.) \ 0 r7kert V-3PcvR-eT)r—e\ %;;Ck?-?, f-44..S643),:„f-3 95714-1-- AZ,47.77,- C) ‘,.) AA.x=4ZA-1--)S 1/4 n/7( _ 970/ 7 o +t.•+ kZ-S=6A/ C. 3,310 \-1s-crl-Yrkx.R (v. 1227\4U-1 e 9Y) 7-7/g \E-\ G \P\ SVAP:5 P ‘A --m FAX# m MIAMIBEACH City of Miami Beach, 1700 Convention Center Drive, Marl i Bench, Florida 33139, www.miarnibenchfl.gov PROCUREMENT DIVISION Tel: 305-673-7490 Fax: 786.394.4006 September 27, 2007 RE: ADDENDUM NO. 2 TO INVITATION TO BID (ITB) NO. 47-06/07 — FOR THE PURCHASE AND INSTALLATION OF VIDEO MONITORING EQUIPMENT FOR CITY GARAGES In response requests for additional information received by prospective Bidders by the Administration, the subject ITB is hereby amended as follows: The due date for the receipt of bids has been changed to no later than 3:00 p.m. Eastern time on October 9, 2007. Questions and Answers Q1. Can the elevator cable be UTP (Unshielded Twisted Pair)? Al. This option is available if the city desires, but will require additional transmitters and receivers according to the distances. Q2. Rack enclosures are not mentioned in the bid spec. Please provide preferred make and model or minimum requirements. A2. The City desires a turnkey operation. While not mentioned in the bid specification, the equipment will need to properly located. Q3. Should all camera lenses be Al (Auto Iris) and Vari-Focal? A3. Auto Iris is suggested based on varying light levels, however Vari-focal is not necessary in all locations. (ie -elevators would be fixed focal length). Q4.. The 7th street garage new conduit and camera installation seems to be redundant with the replacement of the existing conduit and cameras. Could there be a clarification on the amount of total cameras for the 7th street garage. Also, the running of the conduit would be overlapped. A4. The existing conduit can be reused, the City requires the contractor to remove and replace existing wire in conduit. in so far as new cameras, that is the contractors responsibility to advise as to number needed and new conduit, wiring would be required. Q5. Are the CCTV systems going to be viewed remotely? If so, is there current network connectivity for each unit? A5. At some point, yes. ITB No 47-06/07 Addendum #2 September 27, 2007 Page 1 of 3 Q6. What type of cable will be available in the elevators for transmission of camera images to the elevator machine room (coaxial or twisted pair cable will be needed)? A6. See above response to question #1. We can transmit on either coax or twisted pair depending on the distances. Q7. Plans show "Mini Domes", however the part number listed is for a Corner Mount. There are no Corner Mount cameras shown on the plans, please advise as to which Mini Dome and where the corner mount cameras are to be installed? A7. We believe that the corner mount cameras are meant for the elevators and that the mini domes are recommended for other locations. Mini dome part number could be DR-2000-EX- VFA3 or VFA9 depending on location and viewing area. Q8. Shall we bid in strict accordance with RFP? The existing equipment installed in the 17th St. garage is not what is listed in the current RFP. A8. Bidders should respond to what is outlined in the ITB and Addendum No. 1. Q9. How will the cameras be monitored? Are there existing analog monitors to be connected? If so how many ? Is there any viewing software needed? A9. At this time, it is site specific monitoring Q10. The Bid calls for a Hybrid Digital Recorder (one that can accommodate 16 analog, hard wired cameras and 4 IP cameras. As all cameras are analog and will be hard wired directly to the Digital Recorder, why do you need a Hybrid model? A10. The Hybrid model provides for maximum flexibility and expansion as well as all the other recording & reliability features required for the project. Q11. Training is not mentioned in bid spec. How many hours will be required (if any) for end user training? A11. The City would expect training Q12. Are all 110 AC outlets provided by customer? Al2. They will be as needed Q13. There are no UPS/Battery back up mentioned in the bid spec. Is this customer provided or should we provide a bid alternate? A13. Yes. Q14. The floor plans do not accurately reflect the existing conditions. A14. As stated in the ITB and Addendum No. 1. the plans are conceptual. It is the bidder's responsibility to bid a system that meets the City's requirements. ITB No 47-06/07 Addendum #2 September 27, 2007 Page 2 of 3 Q15. In the 7th St. garage, where shall the three (3) PIR cameras be mounted in the entrance/exit? There are only two (2) tickets booths and two ticket machines. A15. Two PIR cameras are to be mounted in the booths to view the cashier and the customer paying. The third camera is to be mounted in the office area to record activities of security and parking staff. Q16. Shall we remove all existing equipment from the 7th St. garage? A16. Except for conduit, yes, at the contractor's expense. Q17. Shall conduit be painted? If yes, shall we include in our price or specify that conduits shall be painted by others. Q17. No painting required unless in the process of the installation contractors damages existing painted areas. There are additional questions and requests for approval of equals that have been submitted by prospective bidders that are still under review and are pending response. Another addendum will be published so as to respond to written questions and requests for approval of equals received by the Administration. Bidders are reminded to please acknowledge receipt of this addendum as part of your bid submission. Potential bidders that have elected not to submit a response to the ITB are requested to complete and return the "Notice to Prospective Bidders" questionnaire with the reason(s) for not submitting a bid. CITY OF MIAMI BEACH Gus Lopez, CPPO Procurement Director ITB No 47-06/07 Addendum #2 September 27, 2007 Page 3 of 3 m MIAMIBEACH City of Miami Beach, 1700 Convention Censer Drive, Miami Beach, Florida 33139, www.miarnibeachfl.gov PROCUREMENT DIVISION Tel: 305-673-7490 Fax: 786.394.4006 October 4, 2007 RE: ADDENDUM NO. 3 TO INVITATION TO BID (ITB) NO. 47-06/07 — FOR THE PURCHASE AND INSTALLATION OF VIDEO MONITORING EQUIPMENT FOR CITY GARAGES The due date for the receipt of bids has been changed to no later than 3:00 p.m. Eastern time on October 17, 2007. There are additional questions and requests for approval of equals that have been submitted by prospective bidders that are still under review and are pending response. Another addendum will be published so as to respond to written questions and requests for approval of equals received by the Administration. Bidders are reminded to please acknowledge receipt of this addendum as part of your bid submission. Potential bidders that have elected not to submit a response to the ITB are requested to complete and return the "Notice to Prospective Bidders" questionnaire with the reason(s) for not submitting a bid. CITY OF MIAMI BEACH Gus Lopez, CPPO Procurement Director ITB No 47-06/07 Addendum #3 October 4, 2007 Page 1 of 1 er:A MIAMIBEACH City of Miami Beach, 1700 Convention Censer Drive, Miami Beach, Florida 33139, www.miarnibeachfl.gov PROCUREMENT DIVISION Tel: 305-673-7490 Fax: 786.3 94.4006 October 12, 2007 RE: ADDENDUM NO. 4 TO INVITATION TO BID (ITB) NO. 47-06/07 — FOR THE PURCHASE AND INSTALLATION OF VIDEO MONITORING EQUIPMENT FOR CITY GARAGES The due date for the receipt of bids has been changed to no later than 3:00 p.m. Eastern time on October 24, 2007. There are additional questions and requests for approval of equals that have been submitted by prospective bidders that are still under review and are pending response. Another addendum will be published so as to respond to written questions and requests for approval of equals received by the Administration. Bidders are reminded to please acknowledge receipt of this addendum as part of your bid submission. Potential bidders that have elected not to submit a response to the ITB are requested to complete and return the "Notice to Prospective Bidders" questionnaire with the reason(s) for not submitting a bid. CITY OF MIAMI BEACH Gus Lopez, CPPO Procurement Director ITB No 47-06/07 Addendum #4 October 12, 2007 Page 1 of 1 m MIAMIBEACH City of Miami Beach, 1700 Convention Center Drive, Miami Beach, Florida 33139, www.miarnibeach(I.gov PROCUREMENT DIVISION Tel: 305-673-7490 Fax: 786.3 94.4006 October 18, 2007 RE: ADDENDUM NO. 5 TO INVITATION TO BID (ITB) NO. 47-06/07 — FOR THE PURCHASE AND INSTALLATION OF VIDEO MONITORING EQUIPMENT FOR CITY GARAGES In response requests for additional information received by prospective Bidders by the Administration, the subject ITB is hereby amended as follows: The due date for the receipt of bids has been changed to no later than 3:00 p.m. Eastern time on October 31, 2007. Cut sheets are attached to be used as reference only when responding to this ITB. The requests for approved equals are still under consideration. Questions and Answers: Q1. Are the elevator camera cables provided by the elevator company in the traveler cable? Al. Yes. Q2. Should we provide tape backup archiving in bid for unlimited archiving of video? A2. As the DVR has approximately 30 day retention period, tape back-up is probably not needed a tape back- up. Any incidents can be pulled from the DVR and saved/stored on separate media. Q3. Should we provide a rack mounted UPS (Uninterruptible Power Source) for the DVR's in the bid price? A3. This is recommended. Q4. Can the City provide a budget dollar amount for this project? A4. The City reserve the right to adjust the allocation of funds for this project. Q5. Will the city provide the 120V circuits and receptacles required for power suppliers, ups, DVRs, and all head end equipment? A5. Yes. Q6. Wilt the city provide parking decals or validate parking tickets for construction personnel? A6. The selected contractor and their personnel will not need to pay for parking while working in the garages. ITB No 47-06/07 Addendum #5 October 18, 2007 Page 1 of 3 Q7. Does the 2 year service contract included the first year warranty period or is it additional to the first year warranty? A7. In addition to the first year warranty. Q8. What type of cable will be available in the elevators for transmission of camera images to the elevator machine room (coaxial or twisted pair cable will be needed)? A8. We can transmit on either coaxial or twisted pair, depending on the distances. UTP can be an option, however, may require additional transmitters and receivers, according to the distance. Q9. Where will the elevator cameras be powered from, the elevator cab or the elevator control room? A9. It is up to the bidder to determine the best solution, based on their expertise and industry practices. Depending on distance and gauge of wire, it may possible to achieve this from either location. Q10. Where is the elevator control room for each garage? A10. Varies by garage. As stated previously, and in Addendum No. 1, bidders are strongly encouraged to perform a walk through of the garages Q11. There are no monitors listed on the equipment list. What size, type and how many for each Digital Recorder? A11. The system could use local monitors, or be accessed through software only. For every 2 DVRs, it is possible to use 1 monitor. Model # can be KLC-15HS for flat panel. The City prefers not to use CRT type screens. Q12. The lens specified in the equipment list is a 2.5-10mm. This will not provide the coverage down a long parking isle. We would suggest using a 5-50mm lens. Al2. This is for the brick cameras, in some locations a 5-50 or 5-33mm lens might be a better choice depending on viewing area. Lens should be chosen according to camera viewing area on a per camera basis, as a result of the walk through. Following are some lens options: KTL-2.5-10VA KTL-2.7-13.5VA KTL-5-50VA KTL-5.5-33VA KTL-7-70VA Q13. The equipment list shows three REG cameras. Please list where each type is to go on the plans. A13. While three potential models are suggested, the City does not require the Mobile REG - Model, as this is a mobile camera. Cameras should be chosen per the application at each location. Q14. Need more information regarding the cameras type indicated on the L.P.R. on the drawings. The cameras are not indicated in the product spec point 3.17. ITB No 47-06/07 Addendum #5 October 18, 2007 Page 2 of 3 A14. See response to No. 13 and attached cut sheets. Q15. Need more information regarding the cameras type indicated as Extreme CCTV REG - D1 Overview Camera indicated in point 3.17. A15. See response to No. 1 and attached cut sheets. Q16. Need more information regarding the cameras type indicated as Extreme CCTV REG - M1 Mobile Design indicated in point 3.17. A16. See response to No. 13. Q17. The pre-existing cameras located in the 13th St garage: Should they be connected to the new system utilizing existing cabling, be replaced utilizing existing cabling, or replace cable and camera? A17. Integrate the existing into the new system. Q18. Is the work to be done Monday thru Friday during regular business hours (0700 — 1700 Hrs) or is there a timeframe to work? A18. Work should be performed in the daytime. Weekends are also acceptable. Q19. On the drawings for the garage on the 16th Street , there is a camera on the west wall looking on the outer side of the building for each floor, I do not find the use for it on each floor probably the camera is intended for the stairs. A19. This camera is on the south wall, not west. There is one camera on the 2nd floor only, not all floors. It monitors the entire length of the exterior drive line. Q20: The cameras for the tags shows as dome cameras are they intended to be on the ceiling or on the pedestals? If they are on the ceiling can they be regular cameras with a long lens. A20. If this is for LPR, please use the best camera & lens for each application. Another addendum will be published so as to respond to the request for approved equals submitted to the Administration. Bidders are reminded to please acknowledge receipt of this addendum as part of your bid submission. Potential bidders that have elected not to submit a response to the ITB are requested to complete and retum the "Notice to Prospective Bidders" questionnaire with the reason(s) for not submitting a bid. CITY OF MIAMI BEACH Gus Lopez, CPPO Procurement Director ITB No 47-06/07 Addendum #5 October 18, 2007 Page 3 of 3 Security GEC -E 1 * CamPius 2 Experience crisp and cry ;t:,-•. dear images ..,•ith GE's line f Cameiu traditional and d: yynkght can-Ee•ros. The GEC-EVR1 offers high performance, L t m c onfi :arability and ill feature set that make- it, o camera that can 'Day/Night. c : n be used or.ust about :i: application. o . T r GEC- VR1-DN tne Da;/Nig . version „%i:`rru<t:..Pc high -quaky kicures even in to:-ii;1i. ::Y3it' ra Using the latest ultra high- resolution sensor technology, the GEC-EVR1 cameras take surveillance to the next level. Setup is easy with an all-new five -button digital OSD interface. The GEC- EVR1 works great out of the box, but the digital OSD interface offers control of such features as white balance, gain, and iris control, as well as several other common features. Like the original CamPlus, CamPlus 2 offers dual-BNC output, power LED indicator; universal 12 VDC / 24 VAC power input, and a sliding side -control panel to prevent unintended alteration of camera settings. The panel also gives the camera a clean look. Some oftheGEC-EVR1's mare advanced features include privacy masking, digital zoom and horizontal/vertical mirroring. The Day/Night version of the camera. the GE C-EVR1.-DN, uses a removable iR cut filter to produce detailed pictures even in low lighting. The GEC-EVR1-DN allows four types of day/night switching: Lux, manual, schedule, or 10. GECEVR1 high-performance CamP trad us 2 korai security cameras Features Traditional camera; r ro ,%:def 541,0 color, day/nigh- earner a rive%5::0 • /L.c_._.._, 570Ti/Lin r:iaht mode e Four t.ypes of Day/Night. switching • Bieckand :w'hitte movie for low lIght env:ror;r; Merit. * Ali :.ic r'.c.. On Sc.rt n 'Lila; c (OSD) Graphical User interface 1c.e iC3Lii} • • Ens•; • to- five -button . +or -._tuo and c:anfiourotion • Liriive(. o power" input, 12 VDC / 2::i VAC ¢ Ui /CE/`CC/C ci< Listed Americas 503-885-5700 888 -GE -SECURITY (437-3287) faxbock 800-483-2495 info@gesecurity.com www.gesecurity.com Asia tel 852-2907-8108 fax 852-2142-5063 Australia tet 61-3-9259-4700 fax 61-3-9259-4799 Europe tel 32-2-725-11-20 fax 32-2-721-86-13 Latin Americo tel 305-593-4301 fax 305-593-4300 Speciflcations Camera • Image device, EVR1: 1/3 in interline transfer Super HAD CCD • Image device, EVR1-DN: 1/3 in interline transfer EX -View HAD CCD • Signal system: NTSC standard, PAL optional • Pixels: 811 H x 508 V (NTSCI, 795H x 596V (PAL) • Scanning system: 525/60 lines (NTSC), 625/50 lines (PAL) • Synchronizing system. Internal/line-lock; phase adjustable • Resolution: 540 TVL standard or in day mode; 570 TVL in night mode • Sensitivity, GEC-EVR1: • 0.05 lux (faceplate) • 0.5 lux @ (1.2 (SAGC, 30 IRE) • Sensitivity, GEC-EVR1-DN: • 0.01 lux (faceplate) • 0.1 lux @f1.2 (SACC, 30 IRE) • 0.001 lux in b/w mode (faceplate) • 0.01 lux @ f1.2 (SACC, 30 IRE) • 0 lux visible light under IR illumination (780 NM to 1100 NM) • Signal-to-noise ratio: > 50 dB • Electronic shutter: Automatic - 1/60 (1/50) to 1/100,000 sec: Manual -- 1/60 (1./50) to 1/10,000 selectable • Color balance: ATW, AWB • Gain: 15 steps adjustable (0 to 15) = Auto backlight compensation: Off/On • Gamma correction: 0.45/1.0; Gamma has 8 curves selectable • Video output: Composite 1.0 V p -p at 75 ohm load • Lens mount: C / CS • Lens options: Accepts manual. video, and DC autoiris lenses Dirner sioracal diagram 5.55 in.. (141 ) 5,04 in. (128 8f 0 Environmental • Operating ternperoture: -4 to 122°F (-20 to 50°C) Electrict2) • Power source: Universa). 10 to 40 VDC, 18 to 30 VAC • Power consumption: 3.3 N' Physical • Dimensions (LxWxD): 5.55 x 2.76 x 2.05 in. (141. x 70 x 52 mrn) • Weight: 14,5 oz (411 g) Regulatory • UL, CE, FCC, C -Tick Ordering information GEC-EVR1 ComPius 2 standard color camera GEC-EVR1-DN CamPlus 2 day/night camera 2.76 in, (70 min) Y © 2007 GE Security As a company of innovat:on. GE Security reserves the right to change product specifications without. notce. For the latest Product specifications, visit GE Security online at wwvv.GESecurity.corn or contact youE GE Security sales representative. 466-20116 ComPius2 EVR ds12007013_ Security SyrnDecl6phis 4uses ~hvb/la" dmnthot With bath coriveritiOhCii analog corneros and the new tamiv of GE digital network products. This :Jni eolatforno providesogrocefu! rni~xatic,h path to nscordingthe future of;idco,recording -- and atthe some time Record full-size i real tirne on 16 cinalog and four dgaaI channels witii the SymDec 16 plus 4. Using MPEG -4 compression for small but high-quality files, SymDec l6plus 4records ot30frames per second, per channel - aI at Di resolution l720 540). SymDec 16 pius 4 incorporates popuiar features from GE Security's SymDec recorder line: Tripex functionality for srnultaneous viewing, poyhack, and recording of video: full seorch capabilities hy time, date, motion, and alarms; and alarm handling with a history log and alarm notification via e -mall. GE Security software aliows viewing of ive and recorded video from multiple SymDec 16 plus 4 units. t's easy to network and view imaqes from the SymDec 16 p)us 4 via 10/100/1000 GaseT Ethernet. Ever with Iimited bandwidth available, viewing is simple through V -Stream technology that manages the transmission of video over the network. The recorders use Dyricimic P Addressing (DHCP) and support Dynamic Domain Name Server (DDNS) for occess through an easy-to-rernember name instead of IP oddress. Configure the recorder through osleek and modern front panel or use the included SyrnBrovvser software. Svnn8rnw/ser'sinterface ooks and works usi like the front panel, but can he accessed by arry computer with Internet Explorer for fast, remote setup and control Hord drive sizes ronge from 320GB to 3TB to fft all of your storoge needs. Units stay cooler with a uriique Cooling Tunn& design that improves reliability. Anne rack -unit wide by 2U high form factor allows SymDec I6plus 4 to fit easily into a standard I9' inch rock. SyrnDecTM 16 p/us 4 profess {)nq\ 1 --��{]�[}�� r - � video ,.:-;fre(]rnino, recorder SymDeem 16 plus 4 Features ^ Ssoktirnerecording onALL channels 01 resolution " Hybrid MIR with Vo to4|P comerosteonS • V-Stnaorn!echxnl:gy mmr':gex nptv»or;video i�ons/nissi:» o 4audio inputs ° Sleek modern mt.erfece o Unique oiorrnmdicn\vr Ugh�b�r o in|eg/:tedcnSui(e\;|ob:rc SynS*cu/e,Syo,%av,ond 'mUmwser ~ up to 3TB intem:1stenage ° Cooling Tunoe!`y6ssignextends hnrddrivi-fy�e ° DVD burner " VGA, UV|.and corr;:stcvidec, mutouts Suyportsflo�hdrives�r`� h0rddrives Americas 503-885- 5700 888 -GE -SECURITY. (4T7-3287) info@gesecurity.corn www.gesecurty.com, Asia tel 852-2907-8108 fax 852-2142-5063 Australia te) 61-3-9259-4700 fox 61-3-9259-4799 Europe tel 32-2-725-11-20 fax 32-2-721-86-13 Latin America tel 305-593-4301 fax 305-593-4300 User interface Specifications Vireo • Video signal input: 1 V p -p nominal, AGC ronge 0.7 to 1.4 V • Video signal output: 1 V p -p at. 75 ohrn • Input termination: 75 ohm • Horizontal resolution: 720 pixels NTSC / 704 PAL • Vertical resolution: 480 lines NTSC / 540 PAL • Video compression standard: MPEG -4 Audio • Audio input: 315 mV, 400 kOhrns, unbalanced • Audio output: 315 mV, 600 ohms, unbalanced • Audio compression standard MPEG --1. E( stria i • Power supply: 120 to 240 VAC, 50/60 Hz: outoranging adapter Connectors rs • Accessory 1/0 ports: RS -485/422 (2), alarm input (16), Form C alarm relay 14), USB (4) • RS -232 serial port: D8-9 • Cornposite video in: Looping SNC (16) • Composite video out: BNC composite (1), VGA DVI (1) • Audio in: RCA (4) • Audio out: RCA (1) • 10/100/1000 Ethernet port: RJ -45 Bock ptrnei *aka hl VS. ibiaeWa Out! lb lT4RRIiZT q1,R4YMR„40 new— 46, 0 faR -Aur I.^.cer r8 � as.232 '� 3.+rEf.k i Ain= ir$ Ethernet 2 ? - / V&A Mon A & t3 Akkrm Out Environmental • Operating temperature: 32 to 104°F 10 to 40°C) • Storage temperature: -4 to 140°F 1-20 to 60°CI • Relative humidity (noncondensing): 10 to 95% Physical • Dimensions (HxWxD): 3.51 x 17.42 x 19.92 in.189 x 442.5 ; 509 mrn l • Weight: 25 lb. (11.34 kg) Regulatory • FCC, CE, UL Ordering information SymDec 16-4-4-320 SymDec 16+4-640 SymDec 16+4-1.28T SymDec 16+4-2T SymDec 16+4-3T SymDec 16+4 RK Dimensions r�. SymDec 16 plus 4 recorder with 320GB hard drive SymDec 16 plus 4 recorder with 640GB hard drive SymDec 16 plus 4 recorder with 1.28TB hard drive SymDec 16 plus 4 recorder with 2TB hard drive SymDec 16 plus 4 recorder with 3TB hard drive Rack -mount kit for SymDec 16 17.42 in. (4423 n nt( 19 ,92 in, (50 rrarra) r:- F E ilf:111?3CiM7i?f(f: © 2007 GE Security. As. o company of innovation, GE Security reserves the right to change product specifications without notice, For the latest product specifications, visit GE Security online at w,vw.GESecurity.com cr contact your GE Security sales representative. 466-3550-syrrideci6-0-ds i 2007011/ www.i3ESscurity.com Sscurity.c:c m Overview GE Security offers a complete line of 1/3 -inch format lenses. Gui lenses are compact in sire, while offering large apertures for superb low -light performance. High-quality multicoated :Mass lens elements provide excellent contrast and color rendition Aspheric lens surfaces on all models provide corner -to -corner image sharpness at all aperture settings. Ail lenses feature metal CS mounts. Outstanding Features Lenses are available with manual or DC autoiris When using a manual iris lens, the ins is adjusted using a ring on the body of the lens. Thti electronics within the camera automatically compensate for any changes in luminosity. If the camera is to be used 1n an outdoor situation, we recommend using an autoiris lens. An automatic oris adjusts to compensate for changes in light and incorporates a neutral density filter to provide additional protection in bright light conditions. Included in the varifocal line i:; a 2.7 TO to 13 mm day/night lens --designed using special optical glass for extremely low chromatic aberration. --providing sharp round-the-clock surveillance without the need for nighttime refocusing. CCTV Lenses 1/3 -inch Format Variiocal Standard Features 1/3 -inch format sari€acaE leases Manual or DC autoiris Compact • Large aperture for excellent low -light performance • Modern aspheric ions surfaces on all models for superio3 image quality • High-guahity glass lenses with modern melticeating for superb contrast and color rendition • Metal CS mount ,•111,11 01111, 1,11,111111111 CCrillenses Specifications KTL-2.5-10VMATL-2.5-10VA - Focal length: 2.5 to 10 mrn Zoom ratio: 4x Max aperature: F1.4 to 2.7 , MOD: 0.3 m Weight. 77.8 g (VA: 75.99) - Dimensions (mm): 48 x 60 (VA: 50.5 x 601 KTL-2.7-10114/1/1M-27-10VA - Focal length: 2.7 to 13.5 mm 'Zoom ratio: 4.8x Max aperature: F1.3 MOD: 0.3 m Weight. 65.0 g (VA: 70.0 g) , Dimensions (mm). 56.1 x 40.5 x 55.7 (VIA. 56.1 x 40.5 x 55.2) KTL-2.9-81AWK71-2.9-81/A , Focal length: 2.9 to 8 mm Zoom ratio: 2.75x Max aperature: F0.95 MOD: 0.3 m Weight: 35.0 9 (VA: 50.0 g) Dimensions (mm): 36.7 x 33.5 x 51.3 101-3.5-8VM/K71-3.5-8VA Focal length: 3.5 to 8 mm , Zoom ratio: 2.28x Max aperature: F1.4 to 1.96 MOD: 0.3 m Weight. 89.8 g (VA: 76.5 9) Related Diagram Not Applicable GE Security www.GESecurity.com Dimensions (mm): 36 x 48.1 (VA: 47.1 x 45.1) Kfl-5.5-33VM/K71-5.5-33VA - Focal length. 5.5 to 33 mm Zoom ratio: 6x Max aperature. F1.6 MOD: 0.3 m Weight: 148.5 g (VA: 144.5 g) - Dimensions (mm): 42 x 54.5 (VA: 54.3 x 54.5) KTL-5-50VM/KTL-5-50VA Focal length. 5.010 50 mm - Zoom ratio: 10x Max aperature: Fl .3 - MOD: 0.3 m Weight: 95.0 g )VA: 100.0 9) Dimensions (mm): 63.1 x 40.5 x 55.7 )VA: 63.2 x 40.5 x 55.2) 101-7-70VMACTL-7-711VA Focal length: 7.0 to 70 mm Zoom ratio: 10x - Max aperature: F1.8 to 2.17 MOD. 0.3 m to 1.0 at - Weight: 199.5 g ;VA. 201.5 g) Dimensions (mm): 55 x 822 Additional Information , Day/night: No ;except ICEL-2.7-13VM/KIL-2.7-13VA: Yes) Aspheric surface: YES (EEDHES to all models) Ordering Information KTL- ar Manual iris/Focal Length 2.5-IOVM 2.5 to 10 mm 2.7-13%4 2.7 to Ifimm 2.9-8V141 2,9 to 8 atm 3.54VM 3.5 to 8 mu! S-5.33VM 5 to 5.33 :Tar 5401,40 Stu50mno 7-70VM 7 7E.) shm Ma:ling Addresx Americas 4575 Research Way, L-1-1-11 750 800-459-1676 (LIS orilvl Corvallis 00 97333 USA ;el 541-754-9133 www.CiESecuray,com fax 541-754-7162 Auto ical Length 2.5-10VA 23tO 10 ow 2.7-13VA 2.7 to 13 !nm 2.9-0VA 23 to 8 ram 3.54VA 3.5 to 8 min 5.5-33VA to 33mm 5-50VA 5 00 60 rom 7-70VA 7 to 70 mao Asia Europe tel 852-7907-8108 tel 32-2-725-11-20 fax 8522142-5663 fax 32-2-721-86-13 Australia Latin America rei 51-3-9259-4700 tel 305-257-4301 fax 61-3-9259-4799 fax 305-267-4300 As a compalw el narwattan. GE Saceray :ese.aes vie ;;91.1 le charge uaaNct spat:km.1ms noticc fxi Ole latest DIOdUCt saectimatian: GE Secuaty er;me.st www GESamtv 5055 contact 562' GE Seventy sales :cal abentaGac in-i;CTs Leases-2104-05-l'i 22:11:36 NOT GEL EASECI Extreme "erre CCS/ REG -D1 DHC-lmagingTr1 License Plate Capture with Color Overview (Definitive High -Contrast ImagingTM) ::Key Features • Extreme's proprietary DHC -Imaging T" technology for definitive high- contrast license plate capture • Second camera provides overview vehicle images that show shape, color:and other vehicle details. • Precision engineered optics captures plates from vehicles moving up to 100mph (-160kph) for high speed applications Metaphase -LEDs deliver powerful infrared illumination for effective license plate capture up to 75ft • Advanced ambient rejection technology solves problems related to glare from :sunlight, headlights and high -beams • 600TVL 1/2" LXR CCD for excellent license plate capture under IR • 480TVL 1/3" LXR CCD for color overview vehicle image • 24/7 license plate capture in day or dark conditions • Energy efficient operation at 12VDC or 24VAC • Installer -friendly design.suitable for harsh weather conditions • Long -life LEDs save time and money by eliminating bulb changes • High-contrast DHC-ImagingTM allows optimal DVR integration or Automatic License•Plate:Recognition (ALPR).performance • DHC -Imaging TM' technology .delivers images. of both conventional plates and DigitarLicense Plates (DLPs) Product Description REG -D1 -featuring DHC -Imaging T" -delivers :advanced performance license plate capture forteehnical.surveillance and represents the third generation of license plate capture solutions from Extreme CCTV. Combining Extreme's latest proprietary technology;DHC-lmagingTM integrates advances in optics, infrared illuminationand Ambient Rejection technology to produce high-contrastlicense plate images characterized by unmatched clarity. Simultaneously, a second camera captures color overview images of vehicles foradditional video evidence. Using solid-state Metaphase -LEDs, REG -D1 achieves an operational range from 12ft to 75ft, previously unattainable for.any LED -based capture system. Combined with Extreme's Ambient Rejection technology, REG -D1 provides -high-contrast license plate capture across the complete spectrum of -ambient lighting conditions from total darkness to direct glare from'suniight or high -beams. Consisting of a 1/2" LXR CCD, DHC -Imaging TM technology captures plates from vehicles moving up to 100mph (160kph). REG-D1's breakthrough speed capability now enables effective license plate capture for highway and other high speed applications. Additionally, DHC-ImagingTo has capture capability for not only conventional plates, but also Digital License Plates (DLPs). A 1/3" LXR CCD equipped with a 5-50mm VF lens captures overview vehicle images in 480TVL color. REG -D1 is housedin:aweather-sealed unit compliant to NEMA4, proven for successful application in extreme environments. The high -efficiency Metaphase -LED array eliminates the need for routine bulb changes while allowing REG -D1 to operate at either 12VDC or 24VAC. REG -D1 integrates seamlessly with industry standard DVRs, IP video servers and wireless broadband equipment. The DHC -Imaging TM technology is precision engineered to deliver high-contrast images for intelligent software platforms such as REG -ALERT for Automatic License Plate Recognition (ALPR) applications. Product Images REG -D1 delivers definitive high-contrast images of license plates. Shown here with EXMB.028B and EXMB.017B bracketry Applications The DHC -Imaging^" technobgy in REG -D1 captures plates from vehicles moving at up to 100mph under any lighting conditions. A second color camera delivers an overview image of the vehicle that shows shape, color and other vehicle details. Govemment buildings Traffic monitoring • Borders • Parkades • Toll Booths • Airports • Hotels • Highways • Private estates • Law enforcement • 12VDC or 24VAC environments • Digital License Plates (DLP) • Automatic License Plate Recognition (ALPR) applications _ '.•L a0o� dre SJ b�CC. 10 Enal d ,•1111( 1100 P5 1: e. tr-�ae..ark �` Extreme C - COT Cxlreme 1,, 1s Ino Dealer / Distributor 'S P" ""^ Derwent Systems Ltd Extreme CCTV/REG-D1 DHC-ImagingTM License Plate Capture with Color Overview (Definitive High -Contrast Imaging I'm) Specifications REG -D1 License Plate Capture with DHC -Imaging TM it it01II I-filarlli I Til. I 11 CCDi' License Plate Capture CCD Color Overview CCD Sensor Resolution 'Effective Pixels 1/2' SX800 Interline LXR CCD 600 TVL EIA: 811 (H) x 508 (V) 1/3" CX600 Interline LXR CCD 480 TVL NTSC: 811 (H) x 508 (V) S/N Ratio Greater than 48dB Greater than 48dB Video Output High-contrast, 1 V p -p @ 75 ohm • Sensitivity Zero lux - works in total darkness Lens Select from below 1 V p -p 75 ohm 0.1 Lux at F1.2 Varifocal 5-50mm with auto -ins Infrared Illumination 850nm LEDs Power Requirements Power Consumption Metaphase -type LEDs, high -efficiency array 12VDC, 3.0A or 24VAC, 1.5A Maximum 27W (2.3A @ 12VDC or 1.2A 24VDC) Color Black standard Construction Operating Temperature Robust cast and extruded aluminum, NEMA 4 compliant • -50°C to 50°C -58°F to 122°F Environmental Weight Dimensions Integral heater and sunshield 383mmLx277mmWx283mmHI15.1"Lx10.9"Wx11.1"H 6.2 kg 1 13.7 lbs Bracketry Not included. Select from optional accessories Power Supply • Not included. Select from optional accessories Lens Selection for License Plate Capture CCD Monochrome Lens Optior45 •16mm Horizontal Field of View 25mm 35mm 50mm 75mm 22° 14° 10° 7° 4° Operational Range Part Numbers Model REG -D1 1 REG -D1 • Lens Selection '• 12-22ft ' • 20-34ft 16: 16mm i 22° H -FOV 12ft to 22ft range 25: 25mm 1 '14° H -FOV 20ft to 34ft range 35: 35mm j 10° H -FOV 1 27ft to 48ft range 50; 50mm 1 7° H -FOV 1 40ft to 68ft range 75: 75mm 1 4° H -FOV l 55ft to 80ft range Signal E: EIA (North America) C: CCIR (Europe) 27-48ft 40-68ft 55-80ft Optional Accessories REG-PS1 EXMB.028 EXMB.029 EXMB.015 EXMB.017 EXMB.061 Power Supply 120VAC to 12VDC or 24VAC (w/ auxiliary output for color overview camera) Cable Managed Wall Bracket U -Bracket Pole Mount Adapter Wall Mount Adapter Pole Top Bracket Note: Extreme CCTV power supply units for in -field REG-DCxxx, REG-SLxxx models and existing cabling may be used with REG -D1. r'atent Pe 27. c Soc.dicat ons are subject to change without notice RFG is a registered trademarF, of Extreme CCTV Inc Eere,,e•. ✓ nr Ext c rye CCTV International Inc is a sues.dia i of Extreme CCTV In: Dealer / Distributor Extreme CCTV Inc; REG -r71 0-n' P'i. .. r!•'�*.' "!�^^' Derwent Syslems Ltd Extreme CCTV REG -L1 DHC-ImagingTM License Plate Capture (Definitive High -Contrast ImagingTM) Key Features • Extreme's proprietary DHC -Imaging*'" technology for definitive high-contrast license plate capture • Precision.engineered optics captures plates from vehicles moving up to 100mph (-160kph) for high speed applications • Metaphase LEDs deliver powerful infrared illumination for effective license plate capture up to 75ft (23m) • Advanced ambient rejection technology solves problems related to glare from sunlight, headlights and high -beams • 600TVL 1/2" LXR CCD for excellent performance under infrared . • 24/7 license plate capture in day or dark conditions • Energy efficient operation at 12VDC or 24VAC • Small, compact housing with covert, installer -friendly design • Suitable for outdoor use in all-weather conditions • Long -life LEDs save time and money by eliminating bulb changes • High-contrast DHC -Imaging TM allows optimal DVR integration or Automatic License Plate Recognition (ALPR) performance • DHC -Imaging TM technology•delivers images of both conventional plates and Digital' License Plates (DLPs) Product Description REG -L1 - featuring DHC=Imaging,' - deliversadvanced performance license plate capture for technical surveillance and represents the third generation of license plate:capture solutions from Extreme CCTV. Combining Extreme's latest proprietary technology, DHC -Imaging*"" integrates advances.in.optics, infrared illumination and Ambient Rejection technologyto.produce high- contrast license plate images characterized by unmatched clarity. Using solid-state Metaphase -LEDs, REG -L1 achieves an operational range from 12ft to 75ft, previouSly.unattainable for.any LED -based capture system. Combined with Extreme's Ambient Rejection technology, REG -L1. provides high-contrast license plate capture across the complete spectrum of ambient lighting conditions from total darknessto direct glare from sunlightorhigh-beams. Consisting ofa 1/2" LXR CCD, the high speed optical engine within DHC-lmagngTM captures plates from vehicles moving up to 100mph (160kph). REG-Ll's breakthrough speed capability now enables effective license plate capture for highway and other high speed applications. Additionally, DHC -Imaging TM has capture capability for not only conventional plates, but also Digital License Plates (DLPs). REG -L1 is housed in a weather -sealed unit compliant to NEMA4, proven for successful application in extreme environments. The high -efficiency. Metaphase -LED array eliminates the need for routine bulb changes while consuming an average of only 24 watts, allowing REG -L1 to operate at either 12VDC or 24VAC. REG -L1 integrates seamlessly with industry standard DVRs, IP .video servers and wireless broad equipment. The DHC -Imaging TM technology is precision engineered to deliver high-contrast images for in intelligent software platforms such as REG -ALERT for Automatic License Plate Recognition (ALPR) applications. Product Images •: REG=L1, delivers definitive :1:110 -contrast images of '' :license plates. Shown here .,;wi{hE;XMB.028B and `:EXMB Ot5B bracketry. Applications The DHC -Imaging T4 technology in REG -L1 captures plates from vehicles moving at up to 100mph under any lighting conditions including highbeam headlight glare. • Govemment buildings • Traffic monitoring • Borders • Parkades • Toll Booths • Airports • Hotels • Highways • Private estates • Law enforcement • 12VDC or 24VAC environments • Digital License Plates (DLP) • Automatic License Plate Recognition (ALPR) applications Specifications REG -L1 DHC -Imaging TM License Plate Capture (Definitive High -Contrast ImagingTM) REG -L1 License Plate Capture with DHC -Imaging TM General Spectf itattOrIS Sensor 1/2" SX800 Interline LXR CCD Resolution Effective Pixels S/N Ratio 600 TVL EIA: 811 (H) x 508 (V) Greater than 48dB Video Output High-contrast, 1 V p -p @ 75 ohm Sensitivity Infrared Illumination LEDs Zero lux - works in total darkness 850nm Metaphase -type LEDs, high -efficiency array Power Requirements; 12VDC, 3.0A or 24VAC, 1.5A Power Consumption Color Construction Average: 24W (2A c 12VDC) or 24W (1A ( 24VAC) Black standard Robust cast and extruded aluminum, NEMA 4 compliant Operating Temperature -50°C to 50°C 1 -58°F to 122°F Environmental Integraltteaterand sunshield Weight 4.8 kg I 10;6.1bs Dimensions '383mm Lx:1:54mm W x 283mm H 1 15.1" L x 6.1" W x 11.1" H Bracketry .Select from. optional accessories Power Supply Lens Options Select from.gptional accessories 16mm Horizontal Field of View : . 22° :25mm 35mm 50mm 75mm :14° 10° 7° 4° Operational Range . Part Numbers. Model: REG -L1 I REG -L1 12-22ft 20-348 27-48ft I16 I XI El Lens Selection :' 16: 16rnm j 22° H -FOV 1 12ft to 22ft range 25: ' 25mm .l 14° H -FOV 20ft to 34ft range 35: 35mm') 10° H -FOV 1 27ft to 48ft range 50: 50mm I 7° H -FOV 40ft to 68ft range 75: 75mm 1 4° H -FOV 55ft to 80ft range Signal 4 E: EIA (North Amenca) C CCIR (Europe) 40-688 55-808 Optional Accessories REG-PS1 EXMB.028 EXMB.028 EXMB.015 EXMB.Q17 EXMB.061 Power supply 120VAC to 12VDC or 24VAC Cable managed wall bracket U -Bracket Pole Mount Adapter Wall Mount Adapter Pole Top Bracket Note: Extreme CCTV power supply units for in -field REG-SLxxx models and existing cabling may be used with REG -L1. f -,tetPcnd'ng Sp..,f ca_on:; art: subject to chance without notice PEC is a registered trademark of Extreme CCTV Et e ante CCTV nternar.onal Inc ry of Extreme:.: CTV Inc Dealer / Distributor PSC -t 1 O7212'. • e . Extreme CCl V Inc .4 ExtDerwent Systems Ltd Extreme CCTV REG -M1 1 Mobile DHC-ImagingTM License Plate Capture (Definitive High -Contrast ImagingTM) Key Features • Extreme's proprietary DHC-ImagingTM technology for definitive high- :contrast license plate capture • Cruise and capture up to 30mph (50kph) camera speed • Mechanically reinforced to ensure resiliency against vibration, shock, wind, bumps and other severe road conditions • Energy efficient 12VDC operation, powered direct from car battery .Attaches and detaches effortlessly onto any vehicle via industrial heavy duty suction cup mount (optional accessory) • Precision engineered optics captures plates from vehicles moving at speeds up to 100mph (160kph) • Metaphase LEDs deliver powerful infrared illumination for effective license plate:capture up to 50ft (15m) • Advanced ambient rejection technology solves problems related to glare from sunlight, headlights and high -beams • 600TVL 1/2" LXR CCD:for excellent performance under infrared • 24/7 functionality in day or dark conditions • Long -life LEDs save time:and money by eliminating bulb changes • High-contrast DHQ-ImagingT"' allows optimal DVR integration or Automatic License:Plate Recognition (ALPR) performance • DHC -Imagine"' technology.delivers images of both conventional plates and Digital:License Plates (DLPs) Product Description REG -M1 - featuring DHC-tmagingTM' -.delivers advanced performance license plate capture for mobile.surveillance. Representing the third generation of license plate capture solutions from -Extreme, REG -M1 incorporates proprietary DHC-ImagingTM' to produce high-contrast license plate images characterized -by unmatched clarity. REG -M1 is mechanically:reinforced to ensureresiliency against vibration, shock, wind, bumps and other severe Toad conditions. Utilizing stability -enhancing:sub-components, including a fortified intemal chassis, the REG -M1 delivers uncompromised performance under even the worst:road conditions. Solid-state Metaphase -LEDs allow for an operational range from 12ft to 50ft. Combined With Extreme's Ambient Rejection technology, REG -M1 provides high-contrast license plate capture across the complete spectrum of ambient lighting conditions from total darkness to direct glare from sunlight. or high -beams. Consisting of a 1/2" LXR CCD, the high speed optical engine within DHC-ImagingTM" captures plates from vehicles moving up to 100mph (160kph). REG-M1's breakthrough speed capability now enables effective license plate capture for highway and other high speed applications. Additionally; DHC-ImagingTM has capture capability for not only conventional plates, but also Digital License Plates (DLPs). REG -M1 is housed in aweather-sealed unit designed to NEMA4 for application in extreme environments. High -efficiency Metaphase -LEDs eliminate routine bulb changes and consume only 24 watts at 12VDC, allowing REG -M1 to be operated directly from a car battery. REG -M1 integrates seamlessly with industry standard mobile DVRs and wireless broadband equipment. The DHC-ImagingTM' technology is precision engineered to deliver high-contrast images for in intelligent software platforms such as REG -ALERT for Automatic License Plate Recognition (ALPR) applications. Product Images REG -M1 delivers definitive high contrast images of license plates from a mobile platform. Shown here with EXMB.031 B. Applications The DHC-ImagingTM technology in REG -M1 captures plates from vehicles moving at up to 100mph under any lighting conditions including highbeam headlight glare. • Parking enforcement • Law enforcement • Airports • Govemment buildings • Traffic monitoring • Borders • Vehicle surveillance • Hotels • Shopping malls • Highways • Digital License Plates (DLP) • Automatic License Plate Recognition (ALPR) applications Dealer / Distributor Extreme CCTV Inc Derwent Systems Ltd Extreme CCTV REG -M1 1 Mobile DHC-ImagingTM License Plate Capture (Definitive High -Contrast Imaging TM) Specifications REG -M1 License Plate Capture with DHC-ImagingTM General Specifications Sensor 1/2" SX800 Interline LXR CCD Resolution Effective Pixels SiN Ratio 600 TVL EIA: 811 (H) x 508 (V) Greater than 48dB Video Output High-contrast, 1 V p -p @ 75 ohm Sensitivity Infrared Illumination LEDs Zero lux - works in total darkness 850nm Metaphase -type LEDs, high -efficiency array Power Requirements 12/24 VAC (3.0A @ 12VDC) Power Consumption ' Color Construction . . Average: 24W (2A @ 12VDC) Black standard Robust cast and extruded aluminum, NEMA 4 design Operating Temperature -50°C to 500C 1-58°F to 122°F Mechanical Environmental • • Weight Mechanically reinforced against shock and vibration :Thermallyzontrolled for constant intemal temperature : 4.8 kg 1106tbs Dimensions 383mm L x 154mm W x 283mm H115.1" L x 6.1" W x 11.1" H Bracketry Power Supply Not included - select from optional accessories Not included —sefttidt from optional accessories Lens Setection Lens Options 16mm 25mm 35mm 50mm Horizontal Field of Vie* Operational Range Part Numbers 22° 14° 12-22ft 20-34ft Model 1 .REG -M1 I :8 .1 16 I XI EE l R • EG -M1 Lens Selection 16: 16mm 22 H -FOV 1 12ft to 22ft range 25: 25mm'l 14° H -FOV 1 2Ctft to 34ft range 35: 35mm l 10° H -FOV 1 27ft to 48ft range 50: 50mm j 7° H -FOV 1 40ft to 68ft range Signal e E: EIA (North America) C: CCIR (Europe) 10° 27-48ft 7° 40-68ft Optional Accessories EXMB.031B Vehicle suction mount Note: Automatic license plate recognition packages (using intelligent software) are available with REG -M1. Please contact Extreme CCTV for further details. Patent Pending Specifications are subiect to change without notice REG Is a registered trademark of Extreme CCTV Inc REG -Mt_ orn42-, Extremc CCTV Ins 2007 Extreme CCTV International Inc Is a subsidiar,, of Extreme CCTV nc Dealer / Distributor '.....k.....,...".....:.., ,...-::::::..:::, I:1 . •••• 81111111111111111 Extreme CCTV Inc . ' • Derwent Systems Ltd t^v w w. GES'ecjrir1. c a.m Overview The weatherproof, vandal -resistant Rugged Donne features a die-cast housing, an impact -resistant Lsxanc?) dome, tamperproof screws, and a hinged cover for easy setup A durable gasket on the base of the Rugged Dome provides a watertight seal to protect the camera. The dome can withstand temperatures ranging from 14° to 122° F (-10° to 50' C). Outstanding Features The Rugged Dome offers a high-resolution, E view°' camera that incorporates adjustable gain control for low -light performance and excellent infrared response. The camera also features digital signal processing, and its automatic backlight compensation prevents important foreground objects from becoming silhouetted against bright backgrounds. The camera includes e variable high-speed electronic: shutter that compensates for conditions ranging from bright sunlight to low -light environment The Rugged Dome s color camera delivers 480 TV lines of resolution and is sensitive to 0.1 lux. During low -fight conditions, the camera will respond to infrared illumination from an IR source;such as an IR lamp or LEDs), providing a clear, high Quality image under 0 lux visible light. The Rugged Dome's day/night lens improves image quality in daylight and during the night under IR illumination. Other cameras available with the Rugged Dome include a black-and=white camera that delivers 580 TV lines of resolution and is sensitive to 0.1 lux, a color camera that delivers 480 TV lines of restilutionaatd is sens,t ;ate to 1.0 lux, or a color/monochrome camera .that delivers 480 TV lutes of,resnlution with a daytime. color image sensitive to 1 lux and a night image that responds to IR illumination and can prridusea clear image under!) lux visible light. Rugged Dome Weatherproof Rugged Dome Camera Standard Features Weatherproof homing / IP66 Discreet design appropriate lar schools, hanks, retail and commercial settings Tamperproof screws and Lexan dome fear vandal resistance Hinged never for easy adjustment and setup High-resolution color and blade -and -white comae options. including EXi iew HAD CCD Day/night iectures provide dear itnages in bright light and In illumination 'aarifocat end fixed lens options UL ted Specifications Common Camera Specifications Signal system: N130/EIA o: Ph1/CCIR option Picture Elements: 811 H x 508 V (NTSC)/795 H x 596 V (PAL) Scanning system 525/60 lir:es (NTSC)/625/50 lines (PAL) Synchronizing system: Internal/line-lock; phase adjustable ▪ Signal-to-noise ratio. >50 dB Electronic shutter: 1/50(1/60) to 1/100,000 sec Backlight compensation: Automatic Video output: 1.00 V pk-pk at 75 ohm load EXview Camera Image device. 1/3 in interline transfer EXview HAD CCD ▪ Resolution: 480 TVL Sensitivity: 0.1 lux 0(1.2 (SAGC on, 30 IRE): 0 lux visible light under IR illumination (730 to 1100 rim) •: Color balance: Advance digital autotracking Gain: Automatic '• Power consumption: 3.5 W Color/Monochrome Camera Image device: 1/3 in interline transfer super HAD 000 -• Resolution' 480 TVL. Sensitivity: 1 lux © 11.4, 0 lux under 18 illumination Gain: Max gain 36 dB Power consumption: 2.4 W / 3 1 W Related Diagram 4.1)0 in (101 min) y r 5.32 in (135 mm) (0) GE Security www.GESeci ri ty.col;: -r- Color Camera Image device. 1/3 In interline transfer super HAD 000 Resolution: 480 TVL Sensitivity: 1 111X C fl.4 (minimum illumination); 0.1 lux (faceplate) White balance: Autotracking white balance Power consumption: 160 n1A, 1.9 W @ 12 VDC; 3.8 W 24 VAC B/W Camera > Image device: 1/3 in interline transfer super HAD CCD Resolution: 580 TVL Sensitivity: 0.1 lux ©1.14 (minimum illumination); 0.01 lux (faceplate) Power consumption: 125 in& 1.5 W © 12 VDC; 3 W 24 VAC Mechanical Operating temperature' 14° to 122° F (-10' to 50° 0) 'Weight: 1.8 Ib 1820 g) Electrical Power source: Universal, 10 to 14 VDC / 18 to 40 VAC Accessories DR PPM Indoor/outdoor pendant mount -• DR -vital: Indoor/outdoor wall mount DR -FM: Flush mount kit Ordering Information DR -Tr' I l Camera 12 Sill 15 Color 11 Ct3li3r/?b4oruiC?3rUnur 261 EXview with Day/Night lens 00- Pvlaairxi Add,ess Americas 4575 fiesealch Way, 5TE 250 800-469-;6761U3 only) Corvallis. 00 3733 USA ;el 541-754-9133 w;vw.GESecuniy-Som fax 541-754-7167 OW 1 Lens 3transedssfe a 664 Lens pack" Blank Coaxial C5 8 mat T VIP 12 12 mm 16 15 mm 25525 min 1tP#3 3-8 mm Varifoca€ lk;rtc itis VMS 9.22 mm Varifacttl Auto Dis `4- TXJ. sterijtat irci.. cee a 2.5- and Clift ieec puck Asia 6:rope tel 852-2907-8105 tel 32-2-725-11-20 fax 852- 142-5063 fax 32-2-721-86.13 Australia Latin America tel 51-3-9259-4700 ie1305-267-4301 fax 61-3-9259-4793 fax 305-267-4300 A: a company el 1,1'.4t10,, GE S•xuNy;eye'ves 1:16 r:01 ¢::Lame muco[: speah:,a..mns wftbnul notice ra: me latest:lucuc: soecd:eauonc ora GE Seceuty 11/161. a1 www GESecunty corn r :md6c1 your 5E ieoun:v ;ales :emeY;n7;rv: !PS-iiecled Domes fist-Dii-i1 G0.32:DS lN1}9 RE: Ei15EDl GE Security Product Data Sheet www.GESacirrity.ram Overview The Corner-rneunt Camera features a heavy -gauge, stainless steel housing that fits discreetly into corners. A lockable front cover provides vandal resistance. Although it is designed for indoor applications, the Corner -mount Camera is tugged enough to withstand temperatures from 14° to 122" F 1-1fi° to 50° C). Outstanding Features The Corner -mount Camera comes with easy -to -install, impact resistant Lexan® viewing windows. Clear end tinted window finishes are provided so that you can decide whether or not to obscure view of the cemera within. Rugged stainless steel housing and lockable, vandat-resistant cover make the Comer -mount Camera ideal for industrial settings such as freight elevators. Choose from a brushed stainless or gray finish. The Corner -mount Camera can be purchased with high resolution Ultra Line or standard resolution Premier Line black -and -white or color cameras. From the Ultra Line, you ran select a black -and -white camera that delivers 5801V lines of resolution and is sensitive to 0.1 lux or a color camera that delivers 480 1V lines of resolution and is sensitive to 1.0 lux. For standard resolution cameras, the Premier Line offers a black -and -white camera with 425 1V lines oP resolution with sensitivity to 0.1 tux and a color camera that gives 380 TV lines of resolution and is sensitive to 1.0 lux Ultra Line options accept 10 to 40 VDC/18 to 30 VAC input voltage; Premier Line options accept 12 VDC only. Corner -Mount Camera Standard Features 9 Heavy -gangs stainless steal indoor housing fits discreetly into corners 9 Lockable cavorter vandal resistance 9 Brushed stainless or gray finish 9 Clear and timed Lexan viewing windows a High and standard resolution black -and -white and color cameras available 9 Wily edjustahle camera position a Various lane options, including an 8 or 12 mm lens, or a 2.5, 4. and 6 mm lens peck Corner-Motfmt Camera Specifications Ultra Line Camera Specification • Signal system: NTSC/EIA standard, PALit:C1H optional • image sensor: 1/3 in interline transfer super HAD CCD • Picture elements: 811 H x 508 V Scanning system: 2:1 interlace -525 lines, 60 fields (NTSC/EIA), option! 625 lines. 50 fields (PAI./CCIR) < Signal-to-noise ratio: > 50 dB (AGC off) = AGC: Max 30 dB Backlight compensation: Automatic histogram on (udder AES), center window weighted Synchronization: Internal/fine Tock AC • Gamma compensation..11.45 • Video output: 1.0 V pk-pk 75 ohm unbalanced = Electronic shutter: AES 1/5011/60 sec) to 1/100,000 sec , Power supply: 10 to 40 VDC/1 B to 30 VAC, isolated, reverse polarity protected • Operating temperature. 140 to 122° F (-10° to 50° Cj 8/W Ultra Line Camera = Resolution; 580 TVI. • Sensitivity: 0.1 lux 41 f1.4 (minimum illumination); 0.01 lux (faceplate) = Power consumption (por camera). 125 mA;1.5 W i 12 VDC, 3 W 4 24 VAC Calor titre tine Camera Resolution: 480 M 0 Sensitivity: 1.0 lux f1.4 (minimum illumination); 0.1 lux (faceplate) = White balance: Auto white balance 2500 to 0500 K Power consumption (per camera)): 160 mA,1.9 W © 12 VDC, 3.8 W 2.4 VAC Related Diagram 3.701 in ram) )_. (4;5,260' mm) 7 250 8r (.- ,150 tom; r .«- tri .r. -.-............ \ I E % § § \` 0 \Ili \ n rt / / 1, _- t .a 72.80 in (184 150 mm) GE Security wwtiv.fiESecurity-tom Prsrnier Lara Camera Specifications = Signal system: NTSC/EIA standard a PAL/CCIR option > Image serum-. 1/3 in interline transfer CCO < Picture elements: 51211 x 49Z V , Scanning system: 2:1 interface -525 lines, 60 fields (NTSC/EIA); optional 825 lines, 50 fields (PALIC(R) > Signal -m -noise ratio: 48 dB (AGC off) • AGC: Max 30 dB = Backlight compensation: On lunder AES), center weighted • Synchloniiation: internal • Gamma compensation: 0.45 > Video output: 1.0 V pk-pk 75 ohm unbalanced • Electronic shutter: AES 1/60 to 1/100,000 sec • Power supply. 12 VDC Operating ten>{,erature: 0° to 140° F 1-18° to Br C) 13/W Premier Line Camera = Resolution: 425 M Sensitivity: 0.1 lux f12 ►minimum illumination); 0.01 lux (faceplate) = Power ronsumptinn: 95 mA, 1.14 W Color Premier Line Camera • Resolution: 380M • Sensitivity: 1.0 lux Of 1.2 (minimum illurnination); 0.1 lux (faceplate) = Power consumption: 120 mA,1.45 W Ordering information CM-; Carrera Type 459 Preiraut BMf. 425 TVI . Nellie! MD Vasatijlltt 586 WI 1669 Vera Calor,4L*TYL 1I 1 Leas Type 21 2.5 rota 4 8 4 12 0 ram 8 nen 8mar 12 arm HewingFinish(Uftra too OW 0 &ray b fuushu4 $usdwca Accessories CM-- 4 r ' 1200 Ultra DAWNS 'IVL,with law peck &cltdes.Z5,4, and 6minbases) 1599 Bens Crian,4aao Wk. with lazes paar finetoda t 2 V,4, and ti mtr ►ants) Mailing Address 4575 Research Way, STE 250 Corvallis. OR 97333 USA www.GESecudry.cum Americas BOO -459-167S IUS only) MI 541-754-9133 fax 541-7547162 Asia Europe lel 852.2907.8198 tel 32-2-725-11-20 fax e52 -2l42-5063 fax 32-2.721-86-13 Australia Latin America tel 611-9259-4M tel 305-767-43111 fax 61-3-9259-4799 fax 315.267-4300 As a ceamrery d inamxt=.r., GE Security ream n the rpM todaepa prxuct 3ecdcawnn wia>,ut nariee. I alae ktr_tMac: spadkse!rans.nsx GE :iaawM nage tri www.GESra:rry.eam e: c°naxt yam CA Sm:KW alt repnwrntatwr IFi La x r.Mourtt.rnen-2WL4e.i6 OZ 2&TIeP1T RttEASEPI KTE-100, KTE-200, KTE-300 ATE -WO • Usable internal dimensions: 2.953 x 2.953 x 10.630 in. (75x 75 x 270 mm) • Power Supply -Camera Power Requirements 12 VDC / 2,1 VAC KTE-100 KTE-200 KTE-300 1,111 -..,0,.1,111 awl 1,10 m.1114.01 0001 LISS i. .If011 KTE- []00 I I 1 Weatherproof Camera Housing P Pole -mount Adapter Weatherproof Camera Housing U Universal Adapter with Sun Shield and Heater Optional Equipment KTE-100/200- n 10.062 le..311.000 00.0 10«.4.4 0611,0* 000, Weatherproof Camera Housing with Sun Shield, Heater, Blower and Cable Management t r<a,a (111.911-a1 LH, b.. 1.111 wr, (o of � MIAMIBEACH City of Miami Beach, 1700 Convention Cenier Drive, Miami Beach, Florida 33139, www..miarnibeachfl.gov PROCUREMENT DIVISION Tel: 305-673-7490 Fax: 786.3 94.4006 October 22, 2007 RE: ADDENDUM NO. 6 TO INVITATION TO BID (ITB) NO. 47-06/07 — FOR THE PURCHASE AND INSTALLATION OF VIDEO MONITORING EQUIPMENT FOR CITY GARAGES The subject ITB is hereby amended as follows: The due date for the receipt of bids has been changed to no later than 3:00 p.m. Eastern time on November 8, 2007. Another addendum will be published so as to respond to the request for approved equals submitted to the Administration. In as much as this Addendum does not contain information that materially changes the ITB, it is not required for Bidders to acknowledge receipt of this addendum as part of your bid submission. Potential bidders that have elected not to submit a response to the ITB are requested to complete and return the "Notice to Prospective Bidders" questionnaire with the reason(s) for not submitting a bid. CITY OF MIAMI BEACH Gus Lopez, CPPO Procurement Director ITB No 47-06/07 Addendum #6 October 22, 2007 Page 1 of 1 MIAMIBEACH City of Miami Beach, 1700 Convention Center Drive. Miami Beach, Florida 33139, www.rniarnibeachft.gov PROCUREMENT DIVISION Tel: 305-673-7490 Fax: 786.394.4006 November 1, 2007 RE: ADDENDUM NO. 7 TO INVITATION TO BID (ITB) NO. 47-06/07 — FOR THE PURCHASE AND INSTALLATION OF VIDEO MONITORING EQUIPMENT FOR CITY GARAGES The subject ITB is hereby amended as follows: In addition to the brands of products listed in the subject ITB and corresponding addenda, the City will accept bids submitted with the alternate products proposed from Vicon Industries, Inc. and IC Realtime Security Solutions. As a reminder, the due date for the receipt of bids remains no later than 3:00 p.m. Eastern time on November 8, 2007. Bidders are reminded to please acknowledge receipt of this addendum as part of your bid submission. Potential bidders that have elected not to submit a response to the ITB are requested to complete and return the "Notice to Prospective Bidders" questionnaire with the reason(s) for not submitting a bid. CITY OF MIAMI BEACH Gus Lopez, CPPO Procurement Director ITB No 47-06/07 Addendum #7 November 1, 2007 Page 1 of 1 gisnet • Thursday, November 08, 2007 City of Miami Beach Procurement Division, 3rd floor 1700 Convention Center Drive Miami Beach, FL 33139 Attention: Procurement Division Subject: Invitation to Bid (ITB) No. 47-06/07 For the purchasing and installation of video monitoring equipment for the City of Miami Beach garages Gisnet Telecom, Inc. (GTI) is pleased to submit this proposal to render the purchase and installation of video monitoring equipment for the City of Miami Beach at five (5) Municipal garages. GTI has been serving the great state of Florida since 1999. Combined we have over twenty years of experience in the installation and maintenance of video monitoring equipment and structured wiring. Also, GTI has a sister company named Gisnet, Inc. that specializes in IT solutions and networking that has been serving the state of Florida since 1992. GTI is a firm who is in the business of providing installation of video monitoring equipment. GTI is a fully equipped and well established company in line with the best business practices in our industry. GTI possesses the financial support, equipment and organization necessary to comply with the "demonstration of competency" section of the subject ITB. GTI is a drug free work place. GTI and all employees conduct themselves in a professional, courteous and ethical manner and we will serve the public with dignity and respect. Just ask a few of our clients: Gator Leasing, Roadway, Amad Logistics, Cayon Development, BF Group, Paramount Companies, Onxy condo residence, Doral Blue condo residence, Opera Tower condo residence, Master Electric, RC Aluminum, Intersect, Executive Protective Solutions, A+ Mini Storage, Baptist Hospital, South Miami Hospital, Veterans Hospital, Daniels, Kashtan, Downs, Robert PA, Fieldstone, Lester and Shear PA, Kresse & Associates PA, Ford Motor Company and Dade County Schools. GTI is fully licensed, certified, insured and members of the following organizations: Latin Builders Association, Microsoft Gold Partners, Greater Miami Chamber of Commerce and Aventura Marketing Council. It is GTI's understanding that it is not the intent of these plans and/or specifications to show every minor detail of construction. GTI has provided additional equipment required for a complete video monitoring system. In our professional opinion the following is a detailed list of additional equipment required that we have clearly identified and included in our proposal: 24V to 12V converter, Minuteman 3000VA on-line rack/wall/tower ups battery backup, Minuteman extemal battery back pack for ED3000RM2U, Chatsworth wall mount rack enclosure black with tinted door and a fire retardant wood back board. Also, as requested in section number 2.15 of the subject ITB GTI's hourly rate is $65.00 per hour and our over time rate is $100.00 per hour. All structured wiring shall be routed through emt conduit with compression fittings and/or rigid metal conduit. There will be no exposed wiring. If any equipment is determined to be defective during the warranty period a City of Miami Beach representative is to notify GTI in writing. Upon receipt of the service request GTI will respond to the service request within eight (8) hours during normal business hours. Please refer to our attached quotes. GTI provided one (1) quote per garage with GE products as specified in the original ITB. Also, GTI provided one (1) quote per garage with ICRealtime products as specified in Addendum No. 7. Finally, GTI provided one (1) quote for all garages for a two (2) year extended warranty period as specified in section 3.15 in the original ITB. Thayotpfbr your ti - d we look forward to a mutually rewarding relationship, Feli>d Veloso Head of Telecommu ations Gisnet Telecom, Inc. INVITATION TO BID FOR THE PURCHASE AND INSTALLATION OF VIDEO MONITORING EQUIPMENT FOR CITY GARAGES BID # 47-06/07 BID OPENING: September 25, 2007 AT 3:00 P.M. Pamela Lela, CPPB PROCUREMENT DIVISION 1700 Convention Center Drive, Miami Beach, FL 33139 www.miamibeachfl.gov August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 1 of 43 m MIAMIBEACH City of Miami Beach, 1700 Convention Center Drive, Miami Beach, Florida 33139, www.miamibeachfl.gov PROCUREMENT DIVISION Tel: 305-673-7490, Fax: 786.394.4006 Invitation to Bid (ITB) No. 47-06/07 PUBLIC NOTICE Sealed bids will be received by the City of Miami Beach Procurement Division, 3rd Floor, 1700 Convention Center Drive, Miami Beach, Florida 33139, until 3:00 p.m. on the 25th day of September 2007 for the PURCHASE AND INSTALLATION OF VIDEO MONITORING EQUIPMENT FOR CITY GARAGES At time, date, and place above, bids will be publicly opened. Any bids received after time and date specified will be returned to the Bidder unopened. The responsibility for submitting a bid before the stated time and date is solely and strictly the responsibility of the Bidder. The City is not responsible for delays caused by mail, courier service, including U.S. Mail, or any other occurrence. Purpose: The purpose of this ITB is to establish a contract, by means of sealed bids, with a qualified contractor for the purchase and installation of video monitoring equipment in City garages. A Pre-bid conference will be held on September 6, 2007 at 10:00 a.m. in the City Manager's Large Conference Room, Fourth Floor, City Hall, 1700 Convention Center Drive, Miami Beach, Florida 33139. Attendance (in person or via telephone) to this Pre-bid meeting is encouraged and recommended as a source of information, but is not mandatory. Bidders interested in participating in the pre-bid submission meeting via telephone must follow these steps: (1) Dial the TELEPHONE NUMBER: 1-800-915-8704 (Toll-free North America) (2) Enter the MEETING NUMBER: *2659980* (note that number is preceded and followed by the star (*) key). Bidders who are interested in participating via telephone, please send an e-mail to PamelaLeja@miamibeachfl.gov expressing your intent to participate via telephone at least one business day in advance of the meeting. The City of Miami Beach is utilizing RFP Depot, as an electronic procurement service for automatic notification bid notification opportunities and document fulfillment. RFP Depot allows for vendors to register online and receive notification of new bids, amendments and awards. Vendors with Internet access should review the registration options at the following website: www.rtodeoot.com If you do not have Internet access, please contact the RFP Depot's vendor support group at 800- 990-9339 or 801-765-9245. Any questions or clarifications concerning this Bid shall be submitted in writing by mail, e-mail, or facsimile to the Procurement Division, 3r Floor, 1700 Convention Center Drive, Miami Beach, FL August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 2 of 43 33139, or FAX: (786) 394-4006. The Bid title/number shall be referenced on all correspondence. All questions must be received no later than ten (10) calendar days prior to the scheduled Bid opening date. All responses to questions/clarifications will be sent to all prospective bidders in the form of an addendum. The City of Miami Beach reserves the right to accept any proposal or bid deemed to be in the best interest of the City of Miami Beach, or waive any informality in any proposal or bid. The City of Miami Beach may reject any and all proposals or bids. YOU ARE HEREBY ADVISED THAT THIS INVITATION TO BID IS SUBJECT TO THE FOLLOWING ORDINANCES/RESOLUTIONS, WHICH MAY BE FOUND ON THE CITY OF MIAMI BEACH WEBSITE: htto://www.miamibeachtoovinewcitv/deots/purchase/bidintro.asp • CONE OF SILENCE -- ORDINANCE NO. 2002-3378 • CODE OF BUSINESS ETHICS -- RESOLUTION NO. 2000-23879. • DEBARMENT PROCEEDINGS -- ORDINANCE NO. 2000-3234. • PROTEST PROCEDURES ORDINANCE NO. 2002-3344. • LOBBYIST REGISTRATION AND DISCLOSURE OF FEES -- ORDINANCE NO. 2002-3363 • EQUAL BENEFITS ORDINANCE – ORDINANCE NO. 2005-3494 • CAMPAIGN CONTRIBUTIONS BY VENDORS ORDINANCE NO. 2003-3389 • LIVING WAGE REQUIREMENT—ORDINANCE NO. 2001-3301. Pursuant to City of Miami Beach Living Wage Ordinance, as codified in Chapter 2, Division6, Section 2-407 thru 2-410 of the Miami Beach Code, all service contractors, entering into a contract with the city shall pay to all its employees, a living wage of not less than $8.56 an hour with health benefits, or a living wage of not less than $9.81 an hour without health benefits. For a covered employer to company with the living wage provision by choosing to pay the lower wage scale ($8.56/hour) when a covered employer also provides health benefits, such health benefits shall consist of payment of at least $1.25 per hour toward the provision of health benefits for covered employees and their dependents. Detailed representation of all these ordinances can be found on the City of Miami Beach website at htto://www.miamibeachfi.qov/newcitv/deots/purchase/bidintro.asO Sincerely, * Gus Lopez, CPPO Procurement Director August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 3 of 43 CI MIAMIBEACH City of Miami Beach, 1700 Convention Center Drive, Miami Beach, Florida 33139, www.miamibeachfl.gov PROCUREMENT DIVISION Tel: 305-673-7490, Fax: 786.394.4006 NO BID NOTICE TO PROSPECTIVE BIDDERS ITB #47-06107 If not submitting a bid at this time, please detach this sheet from the bid documents, complete the information requested, and return to the address listed above. NO BID SUBMITTED FOR REASON(S) CHECKED AND/OR INDICATED: ____Our company does not handle this type of product/service. _We cannot meet the specifications nor provide an alternate equal product. _Our company is simply not interested in bidding at this time. OTHER. (Please specify) We do do not want to be retained on your mailing list for future bids for the type or product and/or service. Signature: Title: Company: Note: Failure to respond, either by submitting a bid or this completed form, may result in your company being removed from the City's bid list. August 27 2007 City of Miami Beach !TB No: 47-06/07 Video Monitoring Equipment 4 of 43 VIDEO MONITORING EQUIPMENT BID # 47-06/07 1.0 GENERAL CONDITIONS 1.1 SEALED BIDS: Original copy of Bid submission, as well as any other pertinent documents must be returned in order for the bid to be considered for award. All bids are subject to the conditions specified hereon and on the attached Special Conditions, Specifications and Bid Form. The completed bid plus three (3) copies must be submitted in a sealed envelope clearly marked with the Bid Title to the City of Miami Beach Procurement Division, 3rd floor, 1700 Convention Center Drive, Miami Beach, Florida 33139. Facsimile or e-mailed bids will not be accepted. 1.2 EXECUTION OF BID: Bid must contain a manual signature of an authorized representative in the space provided on the Bid Form. Failure to properly sign bid shall invalidate same and it shall NOT be considered for award. All bids must be completed in pen and ink or typewritten. No erasures are permitted. If a correction is necessary, draw a single line through the entered figure and enter the corrected figure above it. Corrections must be initialed by the person signing the bid. Any illegible entries, pencil bids or corrections not initialed will not be tabulated. The original bid conditions and specifications CANNOT be changed or altered in any way. Altered bids will not be considered. Clarification of bid submitted shall be in letter form, signed by Bidders and attached to the bid. 1.3 NO BID: If not submitting a bid, respond by returning the enclosed bid form questionnaire, and explain the reason. Repeated failure to bid without sufficient justification shall be cause for removal of a supplier's name from the bid mailing list. 1.4 PRICES QUOTED: Deduct any applicable trade discounts and quote firm net prices. Give both unit price and extended total, when requested. Prices must be stated in units of quantity specified in the bidding specifications. In case of discrepancy in computing the amount of the bid, the UNIT PRICE quoted will govern. All prices must be F.O.B. destination, freight prepaid (unless otherwise stated in special conditions). Any discounts for prompt payment should be specified. Award, if made, will be in accordance with terms and conditions stated herein. Cash or quantity discounts offered will not be a consideration in determination of award of bid(s). 1.5 TAXES: The City of Miami Beach is exempt from all Federal Excise and State taxes. State Sales Tax and Use Certificate Number is 85-8012621639C-9. 1.6 MISTAKES: Bidders are expected to examine the specifications, delivery schedules, bid prices and extensions and all instructions pertaining to supplies and services. Failure to do so will be at the Bidder's risk. August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 5of43 1.7 CONDITION AND PACKAGING: It is understood and agreed that any item offered or shipped as a result of this bid shall be the latest new and current model offered (most current production model at the time of this bid). All containers shall be suitable for storage or shipment, and all prices shall include standard commercial packaging. 1.8 UNDERWRITERS' LABORATORIES: Unless otherwise stipulated in the bid, all manufactured items and fabricated assemblies shall be U.L. listed or re-examination listing where such has been established by U.L. for the item(s) offered and furnished. 1.9 BIDDER'S CONDITIONS: The City Commission reserves the right to waive irregularities or technicalities in bids or to reject all bids, or any part of any bid, they deem necessary for the best interest of the City of Miami Beach, Florida. 1.10 EQUIVALENTS: If bidder offers makes of equipment or brands of supplies other than those specified in the following, he must so indicate on his bid. Specific article(s) of equipment/supplies shall conform in quality, design and construction with all published claims of the manufacturer, and shall to be approved by the City's Parking Department, or a City designee. Brand Names: Catalog numbers, manufacturers' and brand names, when listed, are informational guides as to a standard of acceptable product quality level only and should not be construed as an endorsement or a product limitation of recognized and legitimate manufacturers. Bidders shall formally substantiate and verify that product(s) offered conform with or exceed quality as listed in the specifications. Bidder shall indicate on the bid form the manufacturer's name and number if bidding other than the specified brands, and shall indicate ANY deviation from the specifications as listed. Other than specified items offered requires complete descriptive technical literature marked to indicate detail(s) conformance with specifications and MUST BE INCLUDED WITH THE BID. NO BIDS WILL BE CONSIDERED WITHOUT THIS DATA. Lacking any written indication of intent to quote an alternate brand or model number, the bid will be considered as a bid in complete compliance with the specifications as listed on the attached form. 1.11 NON-CONFORMANCE TO CONTRACT CONDITIONS: Items may be tested for compliance with specifications. Item delivered, not conforming to specifications may be rejected and returned at vendor's expense. These items and items not delivered as per delivery date in bid and/or purchase order may be purchased on the open market. Any increase in cost may be charged against the Bidder. Any violation of these stipulations may also result in: A) Vendor's name being removed from the vendor list. B) Ali departments being advised not to do business with vendor. 1.12 SAMPLES: Samples of items, when required, must be furnished free of expense and, if not destroyed, will, upon request, be returned at the Bidder's expense. Bidders will be responsible for the removal of all samples furnished within (30) days after bid opening. All samples will be August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 6 of 43 disposed of after thirty (30) days. Each individual sample must be labeled with Bidder's name. Failure of Bidder to either deliver required samples or to clearly identify samples may be reason for rejection of the bid. Unless otherwise indicated, samples should be delivered to the Procurement Division, 1700 Convention Center Drive, Miami Beach, FL 33139. 1.13 DELIVERY: Unless actual date of delivery is specified (or if specified delivery cannot be met), show number of days (in calendar days) required to make delivery after receipt of purchase order, in space provided. Delivery time may become a basis for making an award. Delivery shall be within the normal working hours of the user, Monday through Friday, excluding holidays, unless otherwise required. 1.14 INTERPRETATIONS: Unless otherwise stated in the bid, any questions concerning conditions and specifications should be submitted in writing to the Procurement Coordinator, 1700 Convention Center Drive, Miami Beach, FL 33139; E-mail PameiaLeiaemiamibeachtoov; Fax (786) 394-4006. 1.15 BID OPENING: Bids shall be opened on the date, time and place specified in this Bid document. All bids received after the date, time, and place shall be returned, unopened. 1.16 INSPECTION, ACCEPTANCE & TITLE: Inspection and acceptance will be at destination unless otherwise provided. Title to/or risk of loss or damage to all items shall be the responsibility of the successful Bidder until acceptance by the buyer unless loss or damage result from negligence by the buyer. If the materials or services supplied to the City are found to be defective or not conform to specifications, the City reserves the right to cancel the order upon written notice to the seller and return product at Bidder's expense. 1.17 PAYMENT: Payment will be made by the City after the items awarded to a vendor have been received, or services provided, inspected, and found to comply with award specifications, free of damage or defect and properly invoiced. Invoices must include the purchase order number. 1.18 DISPUTES: In case of any doubt or difference of opinion as to the items to be furnished hereunder, the decision of the City shall be final and binding on both parties. 1.19 LEGAL REQUIREMENTS: Federal, State, county and city laws, ordinances, rules and regulations that in any manner affect the items covered herein apply. Lack of knowledge by the Bidder will in no way be a cause for relief from responsibility. 1.20 PATENTS & ROYALTIES: The Bidder, without exception, shall indemnify and save harmless the City of Miami Beach, Florida and its employees from liability of any nature or kind, including cost and expenses for, or on account of, any copyrighted, patented, or unpatented invention, process, or article manufactured or used in the performance of the contract, including its use by The City of Miami Beach, Florida. If the Bidder uses any design, device or materials covered by letters, patent, or copyright, it is mutually understood and agreed, without exception, that the bid prices shall include all royalties or cost arising from the use of such design, device, or materials in any way involved in the work. August 27, 2007 City of Miami Beach ITB No: 47-06107 Video Monitoring Equipment 7 of 43 1.21 OSHA: The Bidder warrants that the product supplied to the City of Miami Beach, Florida shall conform in all respects to the standards set forth in the Occupational Safety and Health Act of 1970, as amended, and the failure to comply with this condition will be considered as a breach of contract. Any fines levied because of inadequacies to comply with these requirements shall be borne solely by the Bidder responsible for same. 1.22 SPECIAL CONDITIONS: Any and all Special Conditions that may vary from these General Conditions shall have precedence. 1.23 ANTI -DISCRIMINATION: The Bidder certifies that he/she is in compliance with the non-discrimination clause contained in Section 202, Executive Order 11246, as amended by Executive Order 11375, relative to equal employment opportunity for all persons without regard to race, color, religion, sex or national origin. 1.24 AMERICAN WITH DISABILITIES ACT: To request this material in accessible format, sign language interpreters, information on access for persons with disabilities, and/or any accommodation to review any document or participate in any city -sponsored proceeding, please contact 305-604-2489 (voice), 305- 673-7524 (fax) or 305-673-7218 (TTY) five days in advance to initiate your request. TTY users may also call 711 (Florida Relay Service). 1.25 QUALITY: All materials used for the manufacture or construction of any supplies, materials or equipment covered by this bid shall be new. The items bid must be new, the latest model, of the best quality, and highest grade workmanship. 1.26 LIABILITY, INSURANCE, LICENSES AND PERMITS: Where Bidders are required to enter or go onto City of Miami Beach property to deliver materials or perform work or services as a result of a bid award, the successful Bidder will assume the full duty, obligation and expense of obtaining all necessary licenses, permits and insurance and assure all work complies with all applicable Miami -Dade County and City of Miami Beach municipal code requirements as well as the Florida Building Code, The Bidder shall be liable for any damages or loss to the City occasioned by negligence of the Bidder (or agent) or any person the Bidder has designated in the completion of the contract as a result of his or her bid. 1.27 BID GUARANTY: N/A 1.28 DEFAULT: Failure or refusal of a Bidder to execute a contract or fulfill a purchase order upon award, or withdrawal of a bid before such award is made, may result in forfeiture of that portion of any bid surety required equal to liquidated damages incurred by the City thereby, or where surety is not required, failure to execute a contract as described above may be grounds for removing the Bidder from the Bidder's list. 1.29 CANCELLATION: In the event any of the provisions of this bid are violated by the contractor, the Procurement Director shall give written notice to the contractor stating the deficiencies and unless deficiencies are corrected within ten (10) days, recommendation will be made to the City Commission for immediate cancellation. The City Commission of Miami Beach, Florida August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 8 of 43 reserves the right to terminate any purchase order or contract resulting from this invitation at any time and for any reason, upon giving thirty (30) days prior written notice to the other party. 1.30 BILLING INSTRUCTIONS: Invoices, unless otherwise indicated, must show purchase order numbers, and shall be submitted to the City of Miami Beach, Parking Department, 309 23 Street, Suite 200, Miami Beach, Florida, 33139; with a CODV to the Accounts Payable Department, 1700 Convention Center Drive, Miami Beach, Florida 33139. 1.31 NOTE TO VENDORS DELIVERING TO THE CITY OF MIAMI BEACH: Receiving hours are Monday through Friday, excluding holidays, from 8:30 A.M. to 5:00 P.M., unless otherwise indicated. The Parking Department is to be notified a minimum of one (1) business day prior to delivery. 1.32 SUBSTITUTIONS: The City will not accept substitute shipments of any kind without prior written approval from the City. Bidder(s) is expected to furnish the brand quoted in their bid once awarded, or as designated on the City's purchase order. Any non -authorized substitute shipments will be returned at the Bidder's expense. 1.33 FACILITIES: The City reserves the right to inspect the Bidder's facilities at any time with prior notice. 1.34 BID TABULATIONS: Bidders desiring a copy of the bid tabulation may request same by enclosing a self- addressed stamped envelope with the bid. 1.35 BID PROTEST PROCEDURES Bidders that are not selected may protest any recommendation for Contract award in accordance with City of Miami Beach Ordinance No. 2002-3344, which establishes procedures for resulting protested bids and proposed awards. Protest not timely pursuant to the requirements of Ordinance No. 2002-3344 shall be barred. 1.36 CLARIFICATION AND ADDENDA TO BID SPECIFICATIONS: If any person contemplating submitting a Bid under this Solicitation is in doubt as to the true meaning of the specifications or other Bid documents or any part thereof, the Bidder must submit to the City of Miami Beach Procurement Division at least ten (10) calendar days prior to scheduled Bid opening, a request for clarification. All such requests for clarification must be made in writing and the person submitting the request will be responsible for its timely delivery. Any interpretation of the Bid, if made, will be made only by Addendum duly issued by the City of Miami Beach Procurement Division. The City shall issue an Informational Addendum if clarification or minimal changes are required. The City shall issue a Formal Addendum if substantial changes which impact the technical submission of Bids are required. A copy of such Addendum shall be sent by RFP Depot via e-mail or facsimile to each Bidder receiving the Solicitation that is a subscriber to the RFP Depot notification system. Bidders who are not subscribers to the RFP Depot system are responsible for ensuring that they have received all addenda. In the event of conflict with the original Contract Documents, Addendum shall govern all other Contract Documents to the extent specified. Subsequent addendum shall govern over prior addendum only to the extent specified. The Bidder shall be required to acknowledge receipt of the Formal Addendum by signing in the space provided on the Bid Form. Failure to acknowledge Addendum shall deem its Bid non- responsive; provided, however, that the City may waive this requirement in its best interest. August 27, 2007 ITB No: 47-06/07 City of Miami Beach Video Monitoring Equipment 9 of 43 The City will not be responsible for any other explanation or interpretation made verbally or in writing by any other City representative. 1.37 DEMONSTRATION OF COMPETENCY: 1) Pre -award inspection of the Bidder's facility may be made prior to the award of contract. Bids will only be considered from firms which are regularly engaged in the business of providing the goods and/or services as described in this Bid. Bidders must be able to demonstrate a good record of performance for a reasonable period of time, and have sufficient financial support, equipment and organization to insure that they can satisfactorily execute the services if awarded a contract under the terms and conditions herein stated. The terms "equipment and organization" as used herein shall be construed to mean a fully equipped and well established company in line with the best business practices in the industry and as determined by the City of Miami Beach. 2) The City may consider any evidence available regarding the financial, technical and other qualifications and abilities of a Bidder, including past performance (experience) with the City in making the award in the best interest of the City. 3) The City may require Bidders to show proof that they have been designated as authorized representatives of a manufacturer or supplier which is the actual source of supply. In these instances, the City may also require material information from the source of supply regarding the quality, packaging, and characteristics of the products to be supplies to the City through the designated representative. Any conflicts between this material information provided by the source of supply and the information contained in the Bidder's Proposal may render the Bid non-responsive. 4) The City may, during the period that the Contract or Purchase Order between the City and the successful Bidder is in force, review the successful Bidder's record of performance to insure that the Bidder is continuing to provide sufficient financial support, equipment and organization as prescribed in this Solicitation. Irrespective of the Bidder's performance on contracts awarded to it by the City, the City may place said contracts on probationary status and implement termination procedures if the City determines that the successful Bidder no longer possesses the financial support, equipment and organization which would have been necessary during the Bid evaluation period in order to comply with this demonstration of competency section. 1.38 DETERMINATION OF AWARD The City Commission shall award the contract to the lowest and best Bidder. In determining the lowest and best Bidder, in addition to price, there shall be considered the following: a. The ability, capacity and skill of the Bidder to perform the Contract. b. Whether the Bidder can perform the Contract within the time specified, without delay or interference. c. The character, integrity, reputation, judgment, experience and efficiency of the Bidder. d. The quality of performance of previous contracts. e. The previous and existing compliance by the Bidder with laws and ordinances relating to the Contract. August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 10 of 43 1.39 ASSIGNMENT: The contractor shall not assign, transfer, convey, sublet or otherwise dispose of this contract, including any or all of its right, title or interest therein, or his or its power to execute such contract to any person, company or corporation without prior written consent of the City of Miami Beach. 1.40 LAWS, PERMITS AND REGULATIONS: The Bidder shall obtain and pay for all licenses, permits and inspection fees required for this project; and shall comply with all laws, ordinances, regulations and building code requirements applicable to the work contemplated herein. 1.41 SPOT MARKET PURCHASES: It is the intent of the City to purchase the items specifically listed in this bid from the awarded vendor. However, items that are to be a Spot Market Purchased may be purchased by other methods, i.e. Federal, State or local contracts. 1.42 ELIMINATION FROM CONSIDERATION This bid solicitation shall not be awarded to any person or firm which is in arrears to the City upon any debt, taxes or contracts which are defaulted as surety or otherwise upon any obligation to the City. 1.43 WAIVER OF INFORMALITIES The City reserves the right to waive any informalities or irregularities in this bid solicitation. 1.44 ESTIMATED QUANTITIES Estimated quantities or estimated dollars, if provided, are for City guidance only. No guarantee is expressed or implied as to quantities or dollars that will be used during the contract period. The City is not obligated to place any order for a given amount subsequent to the award of this bid solicitation. Estimates are based upon the City's actual needs and/or usage during a previous contract period. The City for purposes of determining the low Bidder meeting specifications may use said estimates. 1.45 COLLUSION Bids from related parties. Where two (2) or more related parties each submit a bid or proposal for any contract, such bids or proposals shall be presumed to be collusive. The foregoing presumption may be rebutted by presentation of evidence as to the extent of ownership, control and management of such related parties in the preparation and submittal of such bids or proposals. Related parties mean Bidders or proposers or the principals thereof which have a direct or indirect ownership interest in another Bidder or proposer for the same contract or in which a parent company or the principals thereof of one (1) Bidder or proposer have a direct or indirect ownership interest in another Bidder or proposer for the same contract. Bids or proposals found to be collusive shall be rejected. Bidders or Proposers who have been found to have engaged in collusion may be considered non - responsible, and may be suspended or debarred, and any contract resulting from collusive bidding may be terminated for default. 1.46 DISPUTES In the event of a conflict between the documents, the order of priority of the documents shall be as follows: • Any agreement resulting from the award of this Bid (if applicable); then August 27, 2007 City of Miami Beach !TB No: 47-06/07 Video Monitoring Equipment 11 of 43 • Addenda released for this Bid, with the latest Addendum taking precedence; then • The Bid; then • Awardee's Bid. 1.47 REASONABLE ACCOMMODATION In accordance with the Title II of the Americans with Disabilities Act, any person requiring an accommodation at the Bid opening because of a disability must contact the ADA Compliance Coordinator, at the Public Works Department at (305) 673-7080. 1.48 GRATUITIES Proposers shall not offer any gratuities, favors, or anything of monetary value to any official, employee, or agent of the City, for the purpose of influencing consideration of this proposal. 1.49 SIGNED BID CONSIDERED AN OFFER The signed bid shall be considered an offer on the part of the Bidder or contractor, which offer shall be deemed accepted upon approval by the City Commission of the City of Miami Beach, Florida and in case of default on the part of successful Bidder or contractor, after such acceptance, the City may procure the items or services from other sources and hold the Bidder or contractor responsible for any excess cost occasioned or incurred thereby. 1.50 BID CLARIFICATION: Any questions or clarifications concerning this Invitation to Bid shall be submitted in writing by mail or facsimile to the Procurement Department, 1700 Convention Center Drive, Miami Beach, Florida, 33139 via e-mail: PamelaLeia c�D.miamibeachfl.00v, or via fax: (786) 394- 4006. The bid title/number shall be referenced on all correspondence. All questions must be received no later than ten (10) calendar days prior to the scheduled bid opening date. All responses to questions/clarifications will be sent to all prospective bidders in the form of an addendum. NO QUESTIONS WILL BE RECEIVED VERBALLY OR AFTER SAID DEADLINE. 1.51 TIE BIDS: Please be advised that in accordance with Florida Statues Section 287.087, regarding identical tie bids, preference will be given to vendors certifying that they have implemented a drug free work place program. A certification form will be required at the time of Bid submission. 1.52 PUBLIC ENTITY CRIMES (PEC): A person or affiliate who has been placed on the convicted vendor list following a conviction for public entity crimes may not submit a bid on a contract to provide any goods or services to a public entity, may not submit a bid on a contract with a public entity for the construction or repair of a public building or public work, may not submit bids on leases of real property to public entity, may not be awarded or perform work as a contractor, supplier, sub- contractor, or consultant under a contract with a public entity , and may not transact business with any public entity in excess of the threshold amount provided in Sec. 287.017, for CATEGORY TWO for a period of 36 months from the date of being placed on the convicted vendor list. 1.53 DETERMINATION OF RESPONSIVENESS: Determination of responsiveness will take place at the time of bid opening and evaluation. In order to be deemed a responsive Bidder, your bid must conform in all material respects to August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 12 of 43 the requirements stated in their Bid. 1.54 DELIVERY TIME: Bidders shall specify on the attached Bid Form, the guaranteed delivery time (in calendar days) for each item. It must be a firm delivery time, no ranges will be accepted, i.e.; 12-14 days. 1.55 CONE OF SILENCE This invitation to bid is subject to the "Cone of Silence in accordance with Ordinance No. 2002-3378. A copy of all written communication(s) regarding this bid must be filed with the city clerk. 1.56 EQUAL BENEFITS FOR DOMESTIC PARTNERS Proposers are advised that this RFP and any contract awarded pursuant to this procurement process shall be subject to the applicable provisions of Ordinance No. 2005- 3494, entitled "Requirement for City Contractors to Provide Equal Benefits for Domestic Partners (the "Ordinance")." The Ordinance applies to all employees of a Contractor who work within the City limits of the City of Miami Beach, Florida; and the Contractor's employees located in the United States, but outside of the City of Miami Beach limits, who are directly performing work on the contract within the City of Miami Beach. All proposers shall complete and return, with their proposal, the "Declaration: Non- discrimination in Contracts and Benefits" form contained herein. The City shall not enter into any contract unless the proposer certifies that such firm does not discriminate in the provision of Benefits between employees with Domestic Partners and employees with spouses and/or between the Domestic Partners and spouses of such employees. Contractors may also comply with the Ordinance by providing an employee with the Cash Equivalent of such Benefit or Benefits, if the City Manager or his designee determines that: a. The Contractor shall complete and return the "Reasonable Measures Application" contained herein, and the Cash Equivalent proposed; AND. b. The Contractor shall complete and return the "Substantial Compliance Authorization Form" contained herein. It is important to note that Contractors are considered in compliance if Contractor provides benefits neither to employees' spouses nor to employees' Domestic Partners. 1.57 TERMINATION FOR DEFAULT If through any cause within the reasonable control of the successful Bidder, it shall fail to fulfill in a timely manner, or otherwise violate any of the covenants, agreements, or stipulations material to the Agreement, the City shall thereupon have the right to terminate the services then remaining to be performed by giving written notice to the successful Bidder of such termination which shall become effective upon receipt by the successful Bidder of the written termination notice. In that event, the City shall compensate the successful Bidder in accordance with the Agreement for all services performed by the Bidder prior to termination, net of any costs incurred by the City as a consequence of the default. August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 13 of 43 Notwithstanding the above, the successful Bidder shall not be relieved of liability to the City for damages sustained by the City by virtue of any breach of the Agreement by the Biddor, and the City may reasonably withhold payments to the successful Bidder for the purposes of set off until such time as the exact amount of damages due the City from the successful Bidder is determined. 1.58 TERMINATION FOR CONVENIENCE OF CITY The City may, for its convenience, terminate the services then remaining to be performed at any time without cause by giving written notice to successful Bidder of such termination, which shall become effective thirty (30) days following receipt by Bidder of such notice. In that event, all finished or unfinished documents and other materials shall be properly delivered to the City. lfthe Agreement is terminated by the City as provided in this section, the City shall compensate the successful Bidder in accordance with the Agreement for all services actually performed by the successful Bidder and reasonable direct costs of successful Bidder for assembting and detivering to City alt documents. No compensation shall be due to the successful Bidder for any profits that the successful Bidder expected to earn on the balanced of the Agreement. Such payments shall be the total extent of the City's liability 10the successful Bidder upon a termination as provided for in this section. 1.59 INSURANCE AND INDEMNIFICATION: The contractor shalt be responsibleforhioxvodvandeverypartthereof and for alt matenais, tools, appliances and property of every don.ugedinoonnecbmnVvithUmh*pmrticu|mr project. He shall specifically and distinctly assume, and does so mosumne, all risks of damage or i'urytopropertvorporoqnsusedorernp|oyedqnorinconnectionvviththevxork and of alt damage or injuryjury to any person or property wherever located, resulting from any action or operation under the contract or in connection with the work. It is understood and agreed that at all times the contractor is acting as an independent contractor. The contnacto[, at all times during the full duration of work under this onntract, including extra work in connection with this project shall meet the following requirements: Maintain Worker's Compensation and Employer's Liability Insurance to meet the statutory requirements of the State of Florida. Maintain Comprehensive General Liability Insurance in amounts prescribed by the City (see checklist for limits) to protect the contractor in the interest of the City against all risks of injury to persons (including death) or damage to property wherever located resulting from any action or operation under the contract or in connection with the work. This policy is to provide coverage for prenmioes/oparmbons, independent contractor, broad form property damage, products/completed operations and contractuat liability. Maintain Automobile Liability Insurance including all owned, non -owned or hired automobiles and equipment used in connection with the work. Maintain any additional coverages required by the Risk Manager as indicated on the Insurance Check List. Name the City of Miami Beach as an additionat insured on alt Ilabitity policies required by this contract. When naming the City of Miami Beach as an additional insured onto your poUoiea, the insurance companies hereby agree and will endorse the policies to state that the City will not be liable for the payment of any premiums or assessments. A copy of the endorsement(s) naming the City of Miami Beach as an additional insured is required and must be submitted to the City's Risk Manager. August 27, 2007 City of Miami Beach ITB No: w -06m No change or cancellation in insurance shall be made without thirty (30) days written notice to the City of Miami Beach Risk Manager. All insurance policies shall be issued by companies authorized to do business under the laws of the State of Florida and these companies must have a rating of at least B+:VI or better per Best's Key Rating Guide, latest edition. Original signed Certificates of Insurance, evidencing such coverages and endorsements as required herein, shall be filed with and approved by the City of Miami Beach Risk Manager before work is started. The certificate must state Bid Number and Title. Upon expiration of the required insurance, the contractor must submit updated certificates of insurance for as long a period as any work is still in progress. It is understood and agreed that all policies of insurance provided by the contractor are primary coverage to any insurance or self-insurance the City of Miami Beach possesses that may apply to a loss resulting from the work performed in this contract. All policies issued to cover the insurance requirements herein shall provide full coverage from the first dollar of exposure. No deductibles will be allowed in any policies issued on this contract unless specific safeguards have been established to assure an adequate fund for payment of deductibles by the insured and approved by the City's Risk Manager. The liability insurance coverage shall extend to and include the following contractual indemnity and hold harmless agreement: "The contractor hereby agrees to indemnify and hold harmless the City of Miami Beach, a municipal corporation, its officers, agents, and employees from all claims for bodily injuries to the public in and up to the amount of $1,000,000.00 for each occurrence and and for all damages to the property of others in and up to the amount of $1,000,000.00 for each occurrence per the insurance requirement under the specifications including costs of investigation, all expenses of litigation, including reasonable attorney fees and the cost of appeals arising out of any such claims or suits because of any and all acts of omission or commission of any by the contractor, his agents, servants, or employees, or through the mere existence of the project under contract". The foregoing indemnity agreement shall apply to any and all claims and suits other than claims and suits arising out of the sole and exclusive negligence of the City of Miami Beach, its officers, agents, and employees, as determined by a court of competent jurisdiction. The contractor will notify his insurance agent without delay of the existence of the Hold Harmless Agreement contained within this contract, and fumish a copy of the Hold Harmless Agreement to the insurance agent and carrier. The contractor will obtain and maintain contractual liability insurance in adequate limits for the sole purpose of protecting the City of Miami Beach under the Hold Harmless Agreement from any and all claims arising out of this contractual operation. The contractor will secure and maintain policies of subcontractors. All policies shall be made available to the City upon demand. Compliance by the contractor and all subcontractors with the foregoing requirements as to carrying insurance and furnishing copies of the insurance policies shall not relieve the contractor and all subcontractors of their liabilities and obligations under any Section or Provisions of this contract. Contractor shall be as fully responsible to the City for the acts and omissions of the subcontractor and of persons employed by them as he is for acts and August 27, 2007 ITB No: 47-06/07 City of Miami Beach Video Monitoring Equipment 15 of 43 omissions of persons directly employed by him. Insurance coverage required in these specifications shall be in force throughout the contract term. Should any awardee fail to provide acceptable evidence of current insurance within seven days of receipt of written notice at any time during the contract term, the City shall have the right to consider the contract breached and justifying the termination thereof. If bidder does not meet the insurance requirements of the specifications; alternate insurance coverage, satisfactory to the Risk Manager, may be considered. It is understood and agreed that the inclusion of more than one insured under these policies shall not restrict the coverage provided by these policies for one insured hereunder with respect to a liability claim or suit by another insured hereunder or an employee of such other insured and that with respect to claims against any insured hereunder, other insureds hereunder shall be considered members of the public; but the provisions of this Cross Liability clause shall apply only with respect to liability arising out of the ownership, maintenance, use, occupancy or repair of such portions of the premises insured hereunder as are not reserved for the exclusive use of occupancy of the insured against whom claim is made or suit is filed. August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 16 of 43 ITB No. 47-06/07 Video Monitoring Equipment for City Garages INSURANCE CHECK LIST XXX 1. Workers' Compensation and Employer's Liability per the Statutory limits of the state of Florida. XXX 2. Comprehensive General Liability (occurrence form), limits of liability $ 1.000.000.00 per occurrence for bodily injury property damage to include Premises/ Operations; Products, Completed Operations and Contractual Liability. Contractual Liability and Contractual Indemnity (Hold harmless endorsement exactly as written in "insurance requirements" of specifications). XXX 3. Automobile Liability - $1,000,000 each occurrence - owned/non-owned/hired automobiles included. 4. Excess Liability - $ .00 per occurrence to follow the primary coverages. XXX 5. The City must be named as and additional insured on the liability policies; and it must be stated on the certificate. 6. Other Insurance as indicated: Builders Risk completed value $ .00 Liquor Liability $ .00 Fire Legal Liability $ .00 Protection and Indemnity $ .00 Employee Dishonesty Bond $ .00 Other XXX 7. Thirty (30) days written cancellation notice required. XXX 8. Best's guide rating B+:VI or better, latest edition. XXX 9. The certificate must state the bid number and title BIDDER AND INSURANCE AGENT STATEMENT: We understand the Insurance Requirements of ttl se specifcation insurance may be required within five (5) days aft bi¢�lppeni4�{g. Gisnet Telecom Bidder Signage of Bi er August 27, 2007 City of Miami Beach that evidence of this ITB No: 47-06/07 Video Monitoring Equipment 17 of 43 VIDEO MONITORING EQUIPMENT BID # 47-06/07 2.0 SPECIAL CONDITIONS 2.1 PURPOSE: The purpose of this ITB is to establish a contract, by means of sealed bids, to a qualified contractor for the purchase and installation of video monitoring equipment in City garages. 2.2 TERM OF CONTRACT: This contract shall remain in effect for a period of two (2) years from date of contract execution by the Mayor and City Clerk, and may be renewed at the sole discretion of the City, for three (3) additional one (1) year terms, providing the successful bidder will agree to maintain the same terms and conditions of the current contract. At time of renewal each year, the City may negotiate an adjustment to price based on Consumer Price Index increase. Change shall not be more than the percentage increase or decrease in the Consumer Price Index CPI -U (all urban areas) computed 60 days prior to the anniversary date of the contract. Change shall not be more than the percentage increase or decrease in the Consumer Price Index CPI -U (all urban areas) computed 60 days prior to the anniversary date of the contract. 2.3 METHOD OF AWARD: Award of this contract may be made to the primary and secondary lowest and best Bidders, as defined in General Conditions 1.38, whose bid will be most advantageous to the City of Miami Beach. Should the primary vendor fail to comply with the Terms and Conditions of this Contract, the City reserves the right to award to the secondary vendor, if it is deemed to be in the best interest of the City. 2.4 PAYMENT: Invoices for payment will be submitted after successful delivery, inspection and accepting by the City, and determination of compliance to the specifications. Invoices will be subject to verification and approval by the Parking Department. 2.5 PRICES SHALL BE FIXED AND FIRM FOR TERM OF CONTRACT: If the Bidder is awarded a contract under this bid solicitation, the prices quoted by the Bidder on the Bid Form shall remain fixed and firm during the term of this contract; provided, however, that the Bidder may offer incentive discounts from this fixed price to the City at any time during the contractual term. The City is also interested in receiving bids that include flexible pricing terms that provide the City with maximum options and flexibility as regulatory and marketplace changes take place. 2.6 SHIPPING TERMS: Prices shall include freight to City's premises, and shall be F.O.B. Destination. Vendor shall hold title to the goods until such time as they are delivered to, and accepted by, an authorized City representative. August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 18 of 43 2.7 PRE-BID CONFERENCE: A Pre-bid conference will be held on September 6, 2007 at 10:00 a.m. in the City Manager's Large Conference Room, Fourth Floor, City Hall, 1700 Convention Center Drive, Miami Beach, Florida 33139. Attendance (in person or via telephone) to this Pre-bid meeting is encouraged and recommended as a source of information, but is not mandatory. Bidders interested in participating in the pre-bid submission meeting via telephone must follow these steps: (1) Dial the TELEPHONE NUMBER: 1-800-915-8704 (Toll-free North America) (2) Enter the MEETING NUMBER: *2659980* (note that number is preceded and followed by the star (*) key). Bidders who are interested in participating via telephone, please send an e-mail to PamelaLeja@miamibeachfl.gov expressing your intent to participate via telephone at least one business day in advance of the meeting. 2.8 VENDOR APPLICATION The City of Miami Beach is utilizing RFP Depot, as an electronic procurement service for automatic notification bid notification opportunities and document fulfillment. RFP Depot allows for vendors to register online and receive notification of new bids, amendments and awards. Vendors with Internet access should review the registration options at the following website: www.rfodeoot.com If you do not have Internet access, please contact the RFP Depot's vendor support group at 800-990-9339 or 801-765-9245. 2.9 CONTACT PERSON: The contact person for this Invitation to Bid is Pamela Leja. The contact person may be reached by phone: 305.673.7490; fax: 786.394.4006; or e-mail: PamelaLeiana.miamibeachfl.aov. Communications between a proposer, Bidder, lobbyist or consultant and Procurement Staff are limited to matters of process or procedure. Requests for additional information or clarifications must be made in writing to the contact person, with a copy to the City Clerk, no later than ten (10) calendar days prior to the scheduled Bid opening date. The City will issue replies to inquiries and any other corrections or amendments it deems necessary in written addenda issued prior to the deadline for responding to the Bid. Bidders should not rely on representations, statements, or explanations other than those made in this Bid or in any written addendum to this Bid. Bidders should verify with the Procurement Division prior to submitting a proposal that all addenda have been received. YOU MUST FAMILIARIZE YOURSELF WITH GENERAL CONDITION 1.55, ENTITLED CONE OF SILENCE, WHICH SETS FORTH THE POLICIES AND PROCEDURES RELATIVE TO ORAL AND WRITTEN COMMUNICATIONS. 2.10 SAMPLES Samples of items, when required, must be furnished free of expense and, if not destroyed, will, upon request, be returned at the Bidder's expense. Bidders will be responsible for the August 27, 2007 ITB No: 47-06/07 City of Miami Beach Video Monitoring Equipment 19 of 43 removal of all samples furnished within (30) days after bid opening. All samples will be disposed of after thirty (30) days. Each individual sample must be labeled with Bidder's name. Failure of Bidder to either deliver required samples or to clearly identify samples may be reason for rejection of the bid. Unless otherwise indicated, samples should be delivered to the Procurement Division, 1700 Convention Center Drive, Miami Beach, FL 33139. 2.11 DELIVERY TIME/RESPONSE TIME: Delivery date will be confirmed at time of placing Purchase Order(s) however, in no way shall the delivery date be a longer period of time than the delivery date specified on the Bidder's bid form. 2.12 LIQUIDATED DAMAGES: Failure to complete work orders within the specified time may result in the successful Bidder being assessed the additional cost incurred by the City (liquidated damages) for any and all costs associated with the service performed by a secondary vendor. 2.13 PERCENTAGE ABOVE VENDOR COST/ DISCOUNTS (From published price lists): Bids for parts and supplies not listed in the bid documents shall be submitted at a percentage above vendor cost or discount from a manufacturer's published price list(s). Evidence of said costs shall be submitted with invoice, for each repair or service call. Proof of costs shall be printed, properly identified, and dated as to issuance and effectiveness. Published price list(s) must be common to, and accepted by, the industry in general. The lists must be printed, properly identified, and dated as to issuance and effectiveness. Revised published prices list(s) may be used as a means of price adjustments. However, all bids are to be firm for a period of 365 calendar days after the bid opening date and revised price list(s) will not be accepted by the City until after that date. Revised published price list(s) will be accepted only in the event of an industry -wide price change, as evidenced by the issuance of revised price lists by the manufacturer. Revised prices will not become effective until revised list(s) are submitted to the City under the vendor cover letter identifying the applicable bid number. Vendor cover letter and pricing list(s) must be dated, signed and submitted to the Procurement Director. 2.14 ESTIMATED QUANTITIES: Quantities, if stated, are for Bidders' guidance only and no guarantee is given or implied as to quantities that will be used during the contract period. Estimated quantities are based upon previous needs. Said estimated quantities may be used by the City for the purpose of evaluating the low Bidder meeting specifications. 2.15 HOURLY RATE: If applicable, Bidders are requested to provide regular and overtime hourly labor rates in the bid proposal form. The hourly rate quoted shall include full compensation for labor, equipment use, travel time, and any other cost to the bidder. 2.16 WARRANTY: The successful Bidder will be required to warranty all work performed and equipment supplied for a period of not less than one year. Option(s) for extended warranty may also August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 20 of 43 be bid. 2.17 PRODUCT/CATALOG INFORMATION: Upon request, Bidders must submit specifications and/or samples on the product(s) they propose to furnish on this bid. The City, after evaluation of the documentation submitted (specs and/or samples), will determine if product is approved as equal to specified. 2.18 REFERENCES (PROVIDE REFERENCES, IN THE CUSTOMER REFERENCE FORM) Each bid must be accompanied by a minimum of six (6) verifiable references, of firms or government organizations for which the contractor is currently furnishing, or has furnished similar type, size and complexity of work or equipment as specified herein. Reference shall include the name of the company, a contact person, contact person's E-MAIL ADDRESS , the telephone number and facsimile number. A BID MAY NOT BE CONSIDERED WITHOUT THIS COMPLETE LIST. 2.19 COMPLETE PROJECT REQUIRED: These specifications describe the equipment to be supplied and delivered The scope of these specifications is to insure the delivery of complete units, ready for operation. Failure to list any items or classes under scope of the several sections shall not relieve the contractor from furnishing, installing or performing such work where required by any part of these specifications, or necessary to the satisfactory completion of the project. 2.20 FACILITY LOCATION: Delivery is to be FOB to the City of Miami Beach. 2.21 BIDDER QUALIFICATIONS: In order for bids to be considered, Bidders must submit with their bid, evidence that they are qualified to satisfactorily perform the specified service. Evidence shall include all information necessary to certify that the Bidder: maintains a permanent place of business; has not had just or proper claims pending against him or his firm; and has provided similar type, size and complexity of such work. The evidence will consist of listing of contracts for similar materials that have been provided to public and private sector clients, within the last three (3) years. 2.22 LATE BIDS: At time, date, and place noted herein, bids will be opened. Any bids or proposals received after time and date specified will be returned to the Bidder unopened. The responsibility for submitting a bid/proposal before the stated time and date is solely and strictly the responsibility of the Bidder/proposer. The City is not responsible for delays caused by mail, courier service, including U.S. Mail, or any other occurrence. 2.23 EXCEPTIONS TO SPECIFICATIONS: Exceptions to the specifications shall attached to the Bid Form and shall reference the section. Any exceptions to the General or Special Conditions shall be cause for the bid to be considered non-responsive. Bidders are strongly encouraged to thoroughly review the system and/or experience and qualification requirements set forth in this Bid, specifically the scope of services sections that are identified by the words "must", "shall", and "will". Bidders who fail to satisfy the requirements set forth, may be deemed non-responsive and receive no further consideration. Should your Bid submission not be able to meet one (1) or more of the requirements set forth in this Bid and you are proposing alternatives to said requirements, you must notify the Procurement office in writing at least five days prior to the August 27, 2007 ITB No: 47-06/07 City of Miami Beach Video Monitoring Equipment 21 of 43 deadline for submission of Bids. The City reserves the right to revise the scope of services via addendum prior to the deadline for receipt of Bids. 2.24 COMPLETE INFORMATION REQUIRED ON BID FORM: To be considered a valid bid, the ORIGINAL AND THREE (3) COPIES of the Bid package with all required submittal information must be returned, properly completed, in a sealed envelope as outlined in the first paragraph of General Conditions. 2.25 MAINTENANCE AGREEMENT: If applicable, is to be included, per Scope of Service and Deliverable requirements, as outlined in this ITB. 2.26 EQUAL PRODUCT: Manufacturer's name, brand name and model number are used in these specifications for the purpose of establishing minimum requirement of level of quality, standards of performance and design required, and is not intended to prohibit the bidding of other manufacturer's items of equal material, unless otherwise indicated. Equal product may be bid, provided product so bid is found to be equal in quality, standards of performance, design, etc. to item specified, unless otherwise indicated. Where equal is proposed, bid must be accompanied by complete factory information sheets (specifications, brochures, etc.) and test results of unit bid as equal, and shall to be approved by the City's Parking Department Assistant Director, or his designee. 2.27 CUSTOMER SERVICE: Excellent customer service is the standard of the City of Miami Beach. As contract employees of the City, all employees will be required to adhere to the City's "Service Excellence" standards and expected to conduct themselves in a professional, courteous and ethical manner in all situations. The successful Bidder's employees must work as a cooperative team of well-trained professionals, and must serve the public with dignity and respect. All business transactions with the City will be conducted with honesty, integrity, and dedication. August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 22 of 43 VIDEO MONITORING EQUIPMENT BID # 47-06/07 3.0 SCOPE OF SERVICES GENERAL ELECTRONIC SECURITY REQUIREMENTS The work specified in this bid consists of furnishing all labor, machinery, tools, means of transportation, supplies, equipment, materials, and services necessary, to include permits, to furnish and install video monitoring equipment in the City's garages listed as follows: 7th Street Parking Garage 12th Street Parking Garage 13th Street Parking Garage 16th Street Parking Garage (Anchor Garage) 42nd Street Parking Garage Attached to this Bid is a .pdf file of the conceptual drawings of the above listed garages and and equipment locations. These conceptual drawings for this work are diagrammatic, intended to convey the extent, general arrangement and locations of the required work. Because of the scale of the drawings, certain basic items such as conduit fittings, access panels, cabinet sizes, sleeves, pull boxes, black boxes and junction boxes may not be shown. Bidder's are to Include all items where required by code, other sections, and for proper installation of the work. A CAD version of these drawings on a CD, that may be modified for the purpose of responding to this Bid, is available at the City of Miami Beach Procurement Division, City Hall, 3`d Floor, 1700 Convention Center Drive, fora fee of $10.00. All bidders are to provide their own version of the drawings, signed and sealed by an Engineer 3.1 STIPULATIONS A. The term "Contractor" shall apply to the installation contractor for the specification sections and project drawings. B. The Contractor shall be licensed by the State of Florida as an Electrical Contractor to install all related devices and systems utilized in this project specifically pipe and wire. 3.2 BASIC DESIGN SPECIFICATION REQUIREMENTS A. This section includes basic design requirements specifications for the integrated security management system. Requirements for submittals, quality assurance, product handling, record documents, project conditions, installation demonstrations and training. B. Security Reference Symbols: 1. Symbols used on the drawings are defined in the security symbols schedule of the drawings. Some of the symbols scheduled may not be required for the project symbols. 2. Because of the scale of the drawings, symbols are shown on drawings as close as possible to the mounting location. Verify exact locations with the City. August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 23 of 43 C. The Contractor shall provide the labor, materials, equipment, appliances, services and trgnoportadon, and perform operations in connection with the construction and installation of all equipment. The Contractor shafl be responsibte for securing alt necessary permits in connection with performing and compteting scope of work specified herein. 3.3 REFERENCES AND COMPLIANCES TO THE LATEST EDITIONS, AS RELATED: A. National Electric Code (NEC). B. National Fire Protection Agency (NFPA). C. Underwriters Laboratories (UL). D. Americans with Disability Act (ADA). E. Uniform Building Code (UBC). F. Federat Communications Commission (FCC). G. National Burglar Alarm and Fire Alarm Association. H. Closed Circuit Television Manufacturers Association 3.4 SYSTEM DESCRIPTION A. Design Requirements: 1) Drawings for this work are conceptual and diagrammatic, intended to convey the extent, general arrangement and locations of the required work. Because of the scale of the draxvngs, certain basic items such as conduit fittingo, access panels, cabinet sizes, sleeves, pull boxes, black boxes and junction boxes may not be shown. Include all items where required by code, other sections, and for proper ,nstallation of the work. 2) All splices not terminating at a terminal strip shall be joined with solder and electrical tape utilizing methods indicated in NEC 2002, or by Scotch Lok IDC connectors. 3) Security conductors shalt be minimum #1 8AWG unless otherwise noted. Size conductors in accordance with the equipment manufacturer's recommendations, and NEC to ensure proper operation and alarm notifications. 4) All security shall be routed through conduit or concealed cable tray provided and unstalled by Contractor, unless otherwise indicated, Alt devices wilt be provided with appropriate electrical back boxes, and conduit raceway. All raceways shall be a minimum 3/4 inches unless otherwise noted. Size raceways and install conductors in accordance with the NEC and NFPA and Division 16 requirements. a. EMT conduit with compression fittings b. Rigid metat conduit shall be used in exposed exterior apptications 5) Any and all conduit/raceway required by Contractor for a complete and operating system that is not shown on the project drawings shall be the responsibility of the Contractor. 6) The Contracrohm||supp\yandinota||a|\xvinemndcab|eforaownnp|ete and operational system. 7) Any electrical raceway required by the Contractor beyond what is shown on the drawings shall be factored into the project bid price and shall be the bitity of the Contractor. August 27, 2007 City of Miami Beach ITB No: 47-06/07 8) Outdoor enclosures shall be NEMA 4 rated. 3.5 SUBMITTALS A. Submittal review is considered as general acceptance of the basic applicability of the equipment. Contractor is responsible for the installation of the equipment and/or alternate arrangement of the equipment within a given space. B. All materials and equipment the Contractor proposes to furnish shall be submitted to the Architect/Engineer for review and shall comply with the requirements of Submittals. Data shall be complete in all respects and shall reference, where applicable, to the unit symbol utilized on the Drawings and Specifications. Partial or incomplete submittals are not acceptable. C. Contractor further agrees that if deviations, discrepancies or conflicts between shop drawings and the Specifications are discovered either prior to or after shop drawing submittals are processed by the Engineer, the design Drawings and Specifications shall control and be followed. Review of submittal data shall in no way relieve the Contractor of his duty to perform all work and provide all equipment in strict compliance with the requirements set forth on the drawings herein. D. The Contractor shall submit detailed shop drawings for approval of all equipment to be constructed and installed. Such drawings shall be complete, giving all required information, and shall be properly checked and coordinated with the work of other trades before submission. No work shall be performed until application shop drawings and layout drawings have been approved by the City. E. The Contractor shall submit shop drawings to include dimensions, wiring and block diagrams, conduit sizes, performance data, ratings, control sequences, and all other descriptive data necessary to describe the item proposed and its operating characteristics. F. The Contractor shall submit complete technical data necessary to evaluate the material and equipment. Include a complete technical specification for the submitted equipment, noting differences and adherence to this section. G. Prior to substantial completion, provide 'project record' schematic drawings depicting location of interface, number of conductors, and types of connectors, circuit requirements and type of enclosure. 3.6 QUALITY ASSURANCE A. Contractor shall have no less than 5 years of documented work experience on projects of equivalent size and scope. "Experience" is defined as the completion of an operational security management/control system, with the system being successfully operated by the Contractor's client for its intended purpose for at least one year. B. Equipment specifications may not deal individually with every part, control, or device, which may be required to produce the equipment performance specified or as required August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 25 of 43 to meet the equipment warranties. Contractor is to include such items, as required, for a complete operational system, whether or not specifically indicated. C. If installation of equipment, raceways, cable trays and/or conduit interferes with the work of other trades, the Contractor shall make necessary changes to correct the condition at no additional cost to the City. D. Regulatory Requirements: 1. National Electric Code (NEC) 2. National Fire Protection Association (NFPA) 3. Underwriters Laboratories (UL) 4. Americans with Disabilities Act (ADA) 5. Uniform building code (UBC) 6. Regulations of the: a. Federal Government b. State of Florida c. City of Miami Beach 3.7 PRODUCT DELIVERY, STORAGE AND HANDLING a. Contractor shall protect materials stored on the job site, during construction, and after installation. Contractor shall provide protection of equipment until time of substantial completion b. Contractor shall provide and apply protective material upon receiving the products and maintain throughout the installation process. c. Contractor shall keep products clean and dry, elevating equipment above ground and floor. d. Contractor shall take precautions to protect apparatus and materials from damage e. Failure to protect materials constitutes sufficient cause for rejection of the apparatus or material. f Contractor shall protect factory finish from damage during installation operations and until final acceptance. Restore finished that become stained, scratched, or damaged. 3.8 DOCUMENTS Contractor shall provide complete schematic drawings depicting the location of interface, number of conductors, type of connectors, circuit requirements and type of enclosure. 3.9 PRODUCT CONDITIONS Contractor shall protect active services, water, gas, sewer, and electric, when encountered, against damage. If active services are encountered which require relocation, notify the City promptly in writing. August 27, 2007 City of Miami Beath ITB No: 47-06/07 Video Monitoring Equipment 26 of 43 3.10 MATERIALS 1. Raceway — Comply with drawings provided 2. Provide identification for wiring systems and equipment. 3. Color code junction boxes and enclosures per NEC. Color for security circuits is to be white. 4. Lettering for identification: Sign painters' quality or stencil lettering, using fast drying sign enamel. 5. Identify security equipment panels, system interface cabinets, and similar equipment with 1/2 -inch red lettering. Letter flush panels inside the door to cover. 6.. Engraved laminated plastic tags may be used for identification in lieu of painted lettering. 7. As a minimum of the component/wire label shall meet the following criteria: a. The label shall be made of polyvinyl fluoride material. (Design Basis: Panduit GMT1 Series). b. Self adhesive c. Self Laminating. d. The printable surface shall be white in color for ease of legibility. e. Text shall be minimum of 8 pt bold type, and black in color for ease of legibility. 8. All conductors/cables shall be bundled per NEC and secured by the following method: a. Conductors/ cables bundled and secured using single weather resistant nylon cable ties of sufficient length, on a minimum of 12 inch centers. b. Cable ties shall be of one piece construction — up to 250 lbs. minimum loop tensile strength. c. Cable ties shall be installed by the use of a hand operated, "tool controlled" tension and cut off cable tie installation tool. (Design Basis: Panduit GS Series) 9. Cable ties shall be secured to the security equipment enclosures by the use of screw mount devices. The cable tie mounting device shall not be of adhesive mount construction unless manufactured in combination with the screw mount device. 3.11 INSTALLATION A. Contractor shall provide tamper resistant installation utilizing security fastening devices. B. Contractor shall repair or replace any defective or damaged equipment as required to provide complete and fully operational systems. System is to be retested as necessary and ensure proper operation of system(s). 3.12 QUALITY CONTROL TESTING 1. Contractor shall notify City's representative in writing, in advance of testing. 2. Contractor shall test all systems and place in proper and specified working order prior to demonstration of the system. 3. Contractor shall test system grounds to demonstrate that the ground resistance does not exceed the requirements of the transient voltage surge suppression (TVSS) or exceed the National Electric Code (NEC). 4. Contractor shall perform tests, as required, by authorities having jurisdiction over the site. 5. Testing shall be in the presence of the City's designated representatives, and representatives of the authorities having jurisdiction, all subsystems, features and functions of the system, and shall instruct the City in the proper operation and event August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 27 of 43 sequences of the system. 3.13 INSPECTIONS AND ACCEPTANCE At the completion of the project and prior to final acceptance of the work, Contractor shall provide evidence of final inspections and approvals to the City. 3.14 VIDEO EQUIPMENT The system requires a fully operational multi-camera/monitor microprocessor—based, color closed circuit television system. Design requirements include system expandability to accommodate the addition of multiple cameras and increased coverage areas, incorporation of date/time/title for each connected camera. Closed circuit television equipment allows for the monitoring/viewing of remote areas from one or more controlled stations. Contractor shall provide new digital video recording capability for all new cameras as specified in this bid. Digital recording minimum storage capacity shall be of 3 terabytes per DVR. The Contractor shall be responsible for visiting the sites prior to bid the submission date to be familiar with the existing site conditions. 3.15 WARRANTY A. Warranty period shall be for one year, commencing from the date of final acceptance. Contractor may also submit a bid for an extended warranty. B. Contractor shall agree to repair or replace defective components/materials and to correct defective work when given notice during the warranty period, at no cost to the City. C. Warranty response time is to be within eight (8) hours upon Contractor's receipt of notification by the City, during normal working hours. 3.16 EXTRA MATERIALS PER SITE Contractor shall provide the City with: 1. One (1) camera housing for each type utilized on the project as spare. 2. One (1) power supply for each type utilized on the project as spares. 3. Two (2) camera for each type utilized on the project as spares. 4. Two (2) lenses for each type utilized on the project as spares. 5. Written procedures for obtaining return authorizations (If not required, state so in writing). 3.17 PRODUCTS (See Section 2.26 "EQUAL PRODUCTS") GE Security GEC-EVR1 Color, High -Resolution, 540 TVL, Digital OSD, 24VAC GE Security KTL-2.5-10VA 2.5-10mm, f 1.4 Varifocal, DC Auto Iris Lens August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 28 of 43 GE Security GBC-PI-950-P5 GE Security CM -1500 -LP -S GE Security KTE-100 GE Security KTP -24-16-200 GE Security Sym Dec16+4-3T GE Security Sym Dec 16+4 -RK Extreme CCTV REG -L1 Patented Extreme CCTV REG -D1 Integrated Extreme CCTV REG -M1 August 27, 2007 City of Miami Beach PIR Camera (functional PIR), Color 1/3" CCD, 380 TVL, 3 lux, 5mm Pinhole Tens Corner -mount High Resolution Color, 2.5, 4, and 6mm Lens pack, 10 40VDC/18-30VAC, Brushed Stainless Indoor/Outdoor housing with mount Indoor Power Supply, 16 fused 24 VAC Outputs, 200VA Sym Dec 16 plus 4, 3 TB Hybrid Recorder Sym Dec 16 plus, Rack Mount Kit License Plate Capture Camera Overview Camera Mobile Design End of Section ITB No: 47-06/07 Video Monitoring Equipment 29 of 43 PAYMENT TERMS: NET 30. If other, specify here ANY LETTERS, ATTACHMENTS, OR ADDITIONAL INFORMATION TO BE CONSIDERED PART OF THE BID MUST BE SUBMITTED AS ORIGINAL AND THREE (3) COPIES. Felix V9loso Gisnelt T le o SUBMITTED BY: COMPANY NAME: SIGNED: (I certify tliat I am a-ut prizekl to execute this bid and commit thle bidding fi`rm) Bidders must acknowledge receipt of addendum (if applicable). Addendum No. Addendum No. NAME/TITLE(Print): ADDRESS: City/STATE: TELEPHONE NO: E-MAIL: FACSIMILE NO: FEDERAL I.D.#: August 27, 2007 City of Miami Beach 1 September 12, 2007 Insert Date 3: October 4, 2007 Insert Date Addendum No. Addendum No. 2: September 27, 2007 Insert Date 4: October 12. 2007 Insert Date Felix Veloso / President 2842 N.W. 79th Ave. Doral, FL zip: 33122 (305) 265-0447 Felixv@gisnetnet (305) 500-2712 820543892 Addendum No.5: October 18, 2007 Addendum No.6: October 22, 2007 Addendum No.7: November 1, 2007 ITB No: 47-06/07 Video Monitoring Equipment 30 of 43 CUSTOMER REFERENCE LISTING Bidder's shall furnish the names, addresses, and telephone numbers, E-MAIL addresses. and fax number of a minimum of six (6) private or public organizations for which the Bidder is currently furnishing or has furnished, similar type, size and complexity of equipment as specified herein. All references must be valid and verifiable. 1) Company Name Address Baptist Hospital (South Miami Hospital) 6200 SW 73rd St Miami, FI. 33143 Contact Person/Contract Amount Kevin Jones Telephone No. 786-662-8895 EXT 28895 Fax No.786-662-5072 E-mail kevinj@baptisthealth.net 2) Company Name Gator Leasing Address 4040 NW 72nd Ave Miami, FI. 33166 Contact Person/Contract Amount Felipe Isaza Telephone No. 305-477-4309 Fax No. 305-477-6237 E-mail fisaza@gatorleasing.com 3) Company Name YRCW/Roadway/Yellow Address 11301 NW 134 Street Miami, FI. 33178 Contact Person/Contract Amount DAVE EMERY / JAMES EDWARDS Telephone No. 305-556-1470 E-mail August 27, 2007 City of Miami Beach Fax No.305-817-0298 dave.emery@roadway.com james.edwards@roadway.com ITB No: 47-06/07 Video Monitoring Equipment 31 of 43 CUSTOMER REFERENCE LISTING (CONTD.) 4) Company Name Cayon Developement Group Address 3857 W 16th Avenue Hialeah, FI. 33012 Contact Person/Contract Amount Shaheim Telephone No. 305-823-6721 Fax No. 305-556-7252 E-mail ItorresAcavonfamily.net 5) Company Name RC Aluminum Address 2805 NW 75 Avenue Miami, FI. 33122 Contact Person/Contract Amount Juan Encinosa Telephone No. 305-345-3375 Fax No. 305-592-2184 E-mail . juane@rcalum.com 6) Company Name Master Electric Address 80 NW 22 Avenue Miami, FI. 33125 Contact Person/Contract Amount Duvi Gonzalez Telephone No, 305-642-3721 Fax No. 305-642-3732 E-mail duviel@millenniumpartners.net August 27, 2007 City of Miami Beach ITB No: 47-06/07 Video Monitoring Equipment 32 of 43 DECLARATION: NONDISCRIMINATION IN CONTRACTS AND BENEFITS Section 1. Vendor Information Phone Number: (305)265-0447 Fax Number: Vendor Number (if known): Federal ID or Social Security Number: 820543892 Approximate Number of Employees in the U,S.: 14 (305)500-2712 E-mail: feiixv a@gisnet.net (If 50 or Tess, skip to Section 4, sign and date) Are any of your employees covered by a collective bargaining agreement or union trust fund? _ _Yes x No Union name(s): Section 2. Compliance Questions Question 1. Nondiscrimination - Protected Classes A. Does your company agree to not discriminate against your employees, applicants for employment, employees of the City, or members of the public on the basis of the fact or perception of a person's membership in the categories listed below? Please note: a "YES" answer means your company agrees it will not discriminate; a "NO" answer means your company refuses to agree that it will not discriminate. Please answer yes or no to each category. Race _ Yes _ No E Sex _Yes _ No Color _ Yes _ No W Sexual orientation _ Yes _ No i Creed_ Yes _ No 1Gender identity (transgender status) _ Yes _ No Religion_ Yes _ No Domestic partner status _ Yes _ No ▪ National origin_ Yes _ No 1. Marital status _ Yes _ No ▪ Ancestry_ Yes _ No 7 Disability _ Yes _ No Age _ Yes _ No 1. AIDS/HIV status _ Yes _ No Height _ Yes _ No i Weight _ Yes _ No B. Does your company agree to insert a similar nondiscrimination provision in any subcontract you enter into for the performance of a substantial portion of the contract you have with the City? Please note: you must answer this question, even if you do not intend to enter into any subcontracts. _ Yes _ No August 27, 2007 City of Miami Beach Video Monitoring Equipment ITB No: 47-06/07 Question 2. Nondiscrimination . EquatBenefits for Employees with Spouses and Empbyees wfth Domestic Partners Questions 2A and 2B shoud bo answeredYES evenif your employees must' \ pay some oraUofthe oo��ofspousal ordomauUcpe�nerbene�ta. A. Does your company provtde or offer access to any benefits to employees with spouses or to spouses of employees? _Yao_No B. Does your company provicie or offer accessto any benefits to employees with (same or opposite sexdomestic partners* or to domestic partners of employees? _ Yes Mo *The term DomestiPartner shall mean any two (2) adults of the same or different sex, who have registered as domestic partners wita government body pursuant to state or local law authorizing such registrmdon, or with an internal registry maintained by the employer of at least one of the domestic partners. AContractor may institute anintemo|registry toallow for the provision of equal benefits to employees with domestic partner who do not register their partnerships pursuant to a governmental body authorizing such registration, or who are located in a jurisdiction where no such govemmental domestic partnership exists. A Contractor that institutes such registry shafl not impose criteria for registration that are more stringent than those required for domestic partnership registration by the City of Miami Beach If vou answered "NO" to both Questions 2A and 2B, go to Section 4 (at the bottom of ths page), complete and sign the forrn, fihling in all items requested. If vou answered "YES" to either or both Questions 2A and 2B, please continue to Question 2C below. C. Please check all benefits that apply to your answers above and list in the "other" section any additional benefits not already specified. Note: some benefits are provided to employees because they have a spouse or domestic partnor, such as bereavement leave; other benefits are provided directly to the spouse or domestic partner, such as medical insurance. BENEFIT Health Dental Vision Retirement (Pension, 401(k), etc.) Bereavement Family Leave Parental Leave Employee Assistance Program Relocation & Travel Company Discount, Facilities &Events Credit Union Child Care Other Yes for Employees with Spouses 0 o o o o o o Yes for Employees No, this Documentation of this with Domestic Benefit is Not Benefit is Submitted Partners Offered with this Form o o 0 o o o o o o o o o | | o o o | o o o l o o o 1 o o o | o o o o o o o o o o o Note: If you can not offer a benefit in a nondiscriminatory manner because of reasons o o o o o nawo �u�ozr.cm� 47-06/07 outside your control, (e.g., there are no insurance providers in your area willing to offer domestic partner coverage) you may be eligible for Reasonable Measures compliance. To comply on this basis, you must agree to pay a cash equivalent, submit a completed Reasonable Measures Application with all necessary attachments, and have your application approved by the City Manager, or his designee. Section 3. Required Documentation YOU MUST SUBMIT SUPPORTING DOCUMENTATION to verify each benefit marked in Question 2C. Without proper documentation, your company cannot be certified as complying with the City's Equal Benefits Requirement for Domestic Partner Ordinance. For example, to document medical insurance submit a statement from your insurance provider or a copy of the eligibility section of your plan document; to document leave programs, submit a copy of your company's employee handbook. If documentation for a particular benefit does not exist, attach an explanation. Have you submitted supporting documentation for each benefit offered? _Yes No Section 4. Executing the Document I declares under penalty of perjury under the laws of the and co t, and that I am pthorized to bind this entity ExecutLd t is 7t SignatuAe FelixtVeloso f November, in the year Name of Signatory (please print) President Title State of Florida that the foregoing is true contractually. 2007 , at Doral City 2842 NW 79TH AVE Mailing Address Doral, FI. 33122 City, State, Zip Code FI State August 27, 2007 ITB No: 47-06/07 City Of Miami Beach Video Monitoring Equipment BEACH CITY OF MIAMI BEACH REASONABLE MEASURES APPLICATION Declaration: Nondiscrimination in Contracts and Benefits Submit this form and supporting documentation to the City's Procurement Division ONLY IF you: a. Have taken all reasonable measures to end discrimination in benefits; and b. Are unable to do so; and c. Intend to offer a cash equivalent to employees for whom equal benefits are not available. You must submit the following information with this form: 1. The names, contact persons and telephone numbers of benefits providers contacted for the purpose of acquiring nondiscriminatory benefits; 2. The dates on which such benefits providers were contacted; 3. Copies of any written response(s) you received from such benefits providers, and if written responses are unavailable, summaries of oral responses; and 4. Any other information you feel is relevant to documenting your inability to end discrimination in benefits, including, but not limited to, reference to federal or state laws which preclude the ending of discrimination in benefits. I declare (or certify) under penalty of perjury under the laws of the State of Florida that the foregoing is true and correct, and that I am authorized to bind this entity contractually. Gi net elem Nam ofd m ny (pl a print) Signa ure Felik Veloso Name of Signatory (please print) President Title 2842 NW 79th Ave Mailing Address of Company Doral, FL, 33122 City, State, Zip 305-265-0447 Telephone Number November 7, 2007 Date August 27, 2007 ITB No: 47-06/07 Video Monitoring Equipment City Of Miami Beach Definition of Terms A. REASONABLE MEASURES The City of Miami Beach will determine whether a City Contractor has taken all reasonable measures provided by the City Contractor that demonstrates that it is not possible for the City Contractor to end discrimination in benefits. A determination that it is not possible for the City Contractor to end discrimination in benefits shall be based upon a consideration of such factors as: (1) The number of benefits providers identified and contacted, in writing, by the City Contractor, and written documentation from these providers that they will not provide equal benefits; (2) The existence of benefits providers willing to offer equal benefits to the City Contractor; and (3) The existence of federal or state laws which preclude the City Contractor from ending discrimination in benefits. B. CASH EQUIVALENT "Cash Equivalent" means the amount of money paid to an employee with a Domestic Partner (or spouse, if applicable) in lieu of providing Benefits to the employees' Domestic partner (or spouse, if applicable). The Cash Equivalent is equal to the employer's direct expense of providing Benefits to an employee for his or her spouse. Cash Equivalent. The cash equivalent of the following benefits apply: a. For bereavement leave, cash payment for the number of days that would be allowed as paid time off for death of a spouse. Cash payment would be in the form of wages of the domestic partner employee for the number of days allowed. b. For health benefits, the cost to the Contractor of the Contractor's share of the single monthly premiums that are being paid for the domestic partner employee, to be paid on a regular basis while the domestic partner employee maintains the such insurance in force for himself or herself. c. For family medical leave, cash payments for the number of days that would be allowed as time off for an employee to care for a spouse that has a serious health condition. Cash payment would be in the form of wages of the domestic partner employee for the number of days allowed. August 27, 2007 City Of Miami Beach Video Monitoring Equipment ITB No: 47-06/07 BEACH CITY OF MIAMI BEACH SUBSTANTIAL COMPLIANCE AUTHORIZATION FORM Declaration: Nondiscrimination in Contracts and Benefits This form, and supporting documentation, must be submitted to the Procurement Division by entities seeking to contract with the City of Miami Beach that wish to delay ending their discrimination in benefits pursuant to the Rules of Procedure, as set out below. Fill out all sections that apply. Attach additional sheets as necessary. A. Open Enrollment Ending discrimination in benefits may be delayed until the first effective date after the first open enrollment process following the date the contract with the City begins, provided that the City Contractor submits to the Procurement Division evidence that reasonable efforts are being undertaken to end discrimination in benefits. This delay may not exceed two years from the date the contract with the City is entered into, and only applies to benefits for which an open enrollment process is applicable. Date next benefits plan year begins: Date nondiscriminatory benefits will be available: Reason for Delay: Description of efforts being undertaken to end discrimination in benefits: August 27, 2007 ITB No: 47-06/07 City Of Miami Beach Video Monitoring Equipment B. Administrative Actions and Reouest for Extension Ending discrimination in benefits may be delayed to allow administrative steps to be taken to incorporate nondiscriminatory benefits into the City Contractor's infrastructure. The time allotted for these administrative steps shall apply only to those benefits for which administrative steps are necessary and may not exceed three months. An extension of this time may be granted at the discretion of the Procurement Director, upon the written request of the City Contractor. Administrative steps may inc|ude, but are not limited to, such actions as computer systems rnmdifioationa, personnel policy revioiona, and the development and distribution of employee communications. Description of administrative steps and dates to be achieved: If requesting extension beyond three months, please explain basis: C. Collective Bargaining Agreements (C8A) Ending discrimination in benefits may be delayed until the expiration of a City Contractor's Current collective bargaining agreement(s) where all of the following conditions have been met: 1. The provision of benefits is governed by one or more collective bargaining agreement(s); 2. The City Contractor takes all reasonable measures to end discrimination in benefits either by requesting that the Unions involved agree to reopen the agreements in order for the City Contractor to take whatever steps necessary to end discrimination in benefits or by ending discrimination in benefits without reopening the collective bargaining agreements; and 3. In the event that the City Contractor cannot end discrimination in benefits despite taking all reasonable measures to do so, the City Contractor provides a cash equivalent to eligible employees for whom benefits are not available. Unless otherwise authorized in writing by the Procurement Director, this cash equivalent payment must begin at the time the Unions refuse to allow the collective bargaining August 27, 2007 ITB No: 47-06/0 agreements to be reopened, or in any case no longer than three (3) months from the date the contract with the City is entered into. Fora delay to be granted under this provision, written proof must be submitted with this form that: • The benefits for which the delay is requested are governed by a collective bargaining agreement; • All reasonable measures have been taken to end discrimination in benefits (see Section C.2, above); and • A cash equivalent payment will be provided to eligible employees for whom benefits are not available. I declare (or certify) under penalty of perjury under the laws of the State of Florida that the foregoing is true and correct, and that I am authorized to bind this entity contractually. Name of Company (please print) Gisnet Telecom Mailing Address of Company Dor, I, FL, 33122 City, St1te, ip Signatu je W Felix Veloso 305-265-0447 Name of Signatory (please print) Telephone Number Presiden November 7, 2007 Title Date August 27, 2007 ITB No: 47-06/07 City Of Miami Beach Video Monitoring Equipment MIAMIBEACH City of Miami Beach, 1700 Convention Center Drive, Miami Beach, Florida 33139, www.miomibeachfl.gov PROCUREMENT DIVISION Tel: 305.673.7490 , Fax: 786.394.4006 Date: To: Name of firm and contact filling out survey Phone: Fax: E-mail: Subject: Performance Evaluation of Number of pages including cover: 2 To Whom It May Concern: The City of Miami Beach has implemented a process that collects past performance information on vendors that provide, install and support integrated system solutions. The information will be used to assist City of Miami Beach in the procurement of such services. The company listed in the subject line has chosen to participate in this program. They have listed you as a past client for which they have provided services. Both the company and City of Miami Beach would greatly appreciate you taking a few minutes of your time to complete the accompanying questionnaire. Please review all items in the following document and answer the questions to the best of your knowledge. If you cannot answer a particular question, please leave it blank. Please return this questionnaire to Pamela Leja by Tuesday, September 25, 2007, via fax: 786.304.4006; or e-mail PamelaLeiaamiamibeachfi.00v Thank you for your time and effort. Gus Lopez, CPPO Procurement Director August 27, 2007 ITB No: 47-06/07 City Of Miami Beach Video Monitoring Equipment CA MIAMIBEACH City of Miami Beach, 1700 Convention Center Drive, Miami Beach, Florida 33139, www.miamibeachfl.gov PROCUREMENT DIVISION Tel: 305.673.7490 , Fax: 786.394.4006 PERFORMANCE EVALUATION SURVEY Name of Company Being Evaluated Point of Contact: Phone and e-mail: Please evaluate the performance of the ContractorNendor (10 means you are very satisfied and have no issues with utilizing their services again; 5 is don't know; and 1 is if you would never utilize their services again due to very poor performance). 1 2 3 CRITERIA Ability to manage cost Ability to meet committed installation time Maintenance and support 4 Professionalism and ability to manage project implementation 5 6 7 Level of communication and complete documentation Ability to follow requirements Overall customer satisfaction and hiring again based on performance (comfort level in hiring contractor again) OverallComments: Contact Reference Business Name: Contact Name: Contact Phone and e-mail: Date of Services Estimated Dollar Amount for Services: RATING (1-10) (1-10) August 27, 2007 ITB No: 47-06/07 City Of Miami Beach Video Monitoring Equipment ICRealtime Security Equipment Proposal ITB No. 47-05/06 PURCHASE AND INSTALLATION OF VIDEO MONITORING EQUIPMENT BID FORM Bid shall include all applicable permit fees 1) rh Street Parking Garage $ 68,253.50 No. of Days to Start of Installation (ARO) 2-5 days maximum 3 garages at a time No. of Days from Start to Completion of 2) 12th Street Parking Garage No. of Days to Start of Installation (ARO) No. of Days from Start to Completion of 3) 13th Street Parking Garage No. of Days to Start of Installation (ARO) No. of Days from Start to Completion of 4) 16th Street Parking Garage No. of Days to Start of Installation (ARO) No. of Days from Start to Completion of 5) 42nd Street Parking Garage No.of Days to Start of installation (ARO) No. of Days from Start to Completion of Warranty include —Must be a Minimum of one (1) year (provide details) Extended Warranty Cost (provide details) Twenty Five (25) Business Days 55,147.50 2-5 days maximum 3 garages at a time Twenty (20) Business Days $ 55,966.00 2-5 days maximum 3 garages at a time Twenty (20) Business Days $ 92,761.00 2-5 days maximum 3 garages at a time Thirty-five (35) Business Days $ 77,964.50 2-5 days maximum 3 garages at a time Thirty (30) Business Days One (1) year parts and labor on site warranty is included in the dollar amounts listed above. $ 23,119.00 Two (2) year (in addition to one (1) year already included) parts and labor on site warranty. August 27, 2007 ITB No: 47-06/07 City Of Miami Beach Video Monitoring Equipment 2842 NW 79 AVE - Miami, FL 33122 TEL: 305-265-0447 - FAX: 305-265-0872 http://www.gisnet.net gis n et support@gisnet.net TELECOM CUSTOMER NUMBER: CITYMB ORDER NUMBER: 0002655 ORDER DATE: 9/24/2007 ACCOUNT CONTACT: CUSTOMER PO#: SOLD TO: City of Miami Beach 1100 Washington Ave 4TH Floor MIAMI BEACH, FL 33139 PAGE: 1 SALES REP: Felix Veloso TERMS: NET 10 ORDER CONTACT: SHIP TO: 7TH STREET PARKING GARAGE QUOTE ITEM NUMBER UNIT QUANTITY PRICE AMOUNT WORK TICKET / STEP: 0002655:001:000 STEP DESCRIPTION: ICREALTIME SECURITY EQUIP PROP STATUS: PARTS REQ WORK TICKET / STEP: 0002655:001:001 STEP DESCRIPTION: ICREALTIME SECURITY EQUIP PROP STATUS: PARTS REQ ICR FLEX -16 R30 EACH 2.00 2,024.00 ICREALTIME 16CHANNEL DVR W/ CDRW 1TB HD & 480/480FPS 4,048.00 ICR-PIR EACH 3.00 90.00 270.00 COVERT MOTION DETECTOR CAMERA ICR ELEV CORNER EACH 3.00 178.00 534.00 ICREALTIME ELEVATOR CORNER MOUNT CAMERA ICR-10X-DN EACH 2.00 399.00 798.00 10X ZOOM DAY/NIGHT IR CUT FILTER 570TVL ICR-540CCD EACH 22.00 177.00 3,894.00 HIGH RES DAY/NIGHT 540TVL PRO BODY CAM LENS 2.8-12 Al EACH 22.00 64.00 1,408.00 ICREALTIME 2.8-12MM AUTO IRIS LENS CS MOUNT OUTDOOR HOUSING EACH 22.00 28.00 616.00 ICREALTIME OUTDOOR CAMERA HOUSING M-4 EACH 22.00 12.50 275.00 ICREALTIME LARGE OUTDOOR MOUNT (METAL) ICR 16 CH POWER EACH 2.00 299.00 598.00 16 CHANNEL REGULATED UL POWER SUPPLY gisnet TELECOM CUSTOMER NUMBER: CITYMB ORDER NUMBER: 0002655 ORDER DATE: 9/24/2007 ACCOUNT CONTACT: CUSTOMER PO#: SOLD TO: City of Miami Beach 1100 Washington Ave 4TH Floor MIAMI BEACH, FL 33139 2842 NW 79 AVE - Miami, FL 33122 TEL: 305-265-0447 - FAX: 305-265-0872 http://www.gisnet.net support@gisnet.net ITEM NUMBER QUOTE PAGE: 2 SALES REP: Felix Veloso TERMS: NET 10 ORDER CONTACT: SHIP TO: 7TH STREET PARKING GARAGE UNIT QUANTITY PRICE AMOUNT ED3000RM2U EACH 1.00 1,300.00 1,300.00 MINUTEMAN 3000VA ON-LINE RACK/WALL/TOWER UPS BATTERY BACKUP EDBP72XL EACH 2.00 435.00 870.00 MINUTEMAN EXTERNAL BATTERY PACK FOR ED3000RM2U 11900-724 EACH 1.00 725.00 725.00 CHATSWORTH WALL MOUNT RACK ENCLOSURE 24"H 19"W 24"D BLACK W/ TINTED DOOR. /FIREBACKBOARD EACH 1.00 80.00 80.00 FIRE RETARDANT WOOD BACKBOARD /VIDEO-COAXPWR EACH 8.00 125.00 1,000.00 VIDEO -COAX RG59 SIAMESE POWER (FIRST LEVEL) NIDEO-COAXPWR EACH 4.00 150.00 600.00 VIDEO -COAX RG59 SIAMESE POWER (SECOND LEVEL) NIDEO-COAXPWR EACH 4.00 175.00 700.00 VIDEO -COAX RG59 SIAMESE POWER (THIRD LEVEL) NI DEO-COAXPW R EACH 4.00 200.00 800.00 VIDEO -COAX RG59 SIAMESE POWER (FOURTH LEVEL) /VIDEO-COAXPWR EACH 4.00 225.00 900.00 VIDEO -COAX RG59 SIAMESE POWER (FIFTH LEVEL) NIDEO-COAXPWR EACH 3.00 250.00 750.00 VIDEO -COAX RG59 SIAMESE POWER (ROOF LEVEL) NIDEO-COAXPWR EACH 3.00 150.00 450.00 VIDEO -COAX RG59 SIAMESE POWER (ELEVATOR) /ELECTRICAL EACH 1.00 37, 752.00 37, 752.00 COMPLETE EMT CONDUIT RUN FOR CAMERAS /ACCESORIES EACH 1.00 2,155.50 2,155.50 2842 NW 79 AVE - Miami, FL 33122 TEL: 305-265-0447 - FAX: 305-265-0872 nttp://www.gisnetnet gisnersupport@gisnet.net TELECOM CUSTOMER NUMBER: CITYMB PAGE: 3 ORDER NUMBER: 0002655 SALES REP: Felix Veioso ORDER DATE: 9/24/2007 TERMS: NET 10 ACCOUNT CONTACT: ORDER CONTACT: CUSTOMER PO#: SOLD TO: SHIP TO: City of Miami Beach 7TH STREET PARKING GARAGE 1100 Washington Ave 4TH Floor MIAMI BEACH, FL 33139 ITEM NUMBER QUOTE UNIT QUANTITY PRICE AMOUNT EXTRA MATERIALS REQUESTED AS PER BID#47-06/07 1 CAMERA HOUING OF EACH TYPE 1 POWER SUPPLY OF EACH TYPE 2 CAMERAS OF EACH TYPE 2 LENSES OF EACH TYPE /ACCESORIES EACH 1.00 600.00 600.00 MISC ACCESSORIES /INSTALL EACH 90.00 65.00 5,850.00 INSTALLATION SERVICES COMPLETE INSTALLATION & PROGRAMING OF 2 GE 16CHANNEL DVR'S. COMPLETE INSTALLATION MOUNTING, POINTING & FOCUSING OF 3 PIR CAMERAS. COMPLETE INSTALLATION MOUNTING & FOCUSING OF 3 GE CORNER MOUNT CAMERAS. COMPLETE INSTALLATION MOUNTING, POINTING & FOCUSING OF 2 LICENCE PLATE CAMERAS. COMPLETE INSTALLATION MOUNTING, POINTING & FOCUSING OF 22 FIXED BOX CAMERAS. COMPLETE INSTALLATION & MOUNTING OF 2 16CHANNEL POWER SUPPLY UNITS FOR CAMERA VOLTAGE. /LABOR EACH 1.00 780.00 780.00 COMPLETE PROGRAMING OF DVR'S /WARRANTY EACH 1.00 0.00 0.00 THIS QUOTE INCLUDES ONE (1) YEAR PARTS & LABOR ON-SITE WARRANTY LIGHTNING SURGES & ACTS OF GOD ARE NOT COVERED BY WARRANTY. /PERMIT EACH 1.00 500.00 PERMIT FEES /ITEM EACH 1.00 0.00 SHOP DRAWINGS & AS-BUILTS /REMOVAL EACH 1.00 0.00 COMPLETE REMOVAL OF EXISTING VIDEO MONITORING EQUIPMENT 500.00 0.00 0.00 gisnet TELECOM CUSTOMER NUMBER: CITYMB ORDER NUMBER: 0002655 ORDER DATE: 9/24/2007 ACCOUNT CONTACT: CUSTOMER PO#: SOLD TO: City of Miami Beach 1100 Washington Ave 4TH Floor MIAMI BEACH, FL 33139 2842 NW 79 AVE - Miami, FL.33122 TEL: 305-265-0447 - FAX: 305-265-0872 http://www.gisnet.net support@gisnet.net ITEM NUMBER QUOTE PAGE: 4 SALES REP: Felix Veloso TERMS: NET 10 ORDER CONTACT: SHIP TO: 7TH STREET PARKING GARAGE UNIT QUANTITY PRICE AMOUNT TERMS AND CONDITIONS This Agreement will become effective on the date signed by GISNET's authorized representative below and continue until terminated by either GISNET or Client at any time, with or without cause, by providing at east thirty (30) days prior written notice to the other party. All fees and expenses related to services provided under this Agreement must be paid by Client to GISNET, in full, prior to terrnination. This Agreement will not become effective or binding upon GISNET unless signed and dated by a GISNET authorized representative where indicated below. GISNET shall be solely responsible for staffing decisions with respect to its personnel and the performance of services. GISNET reserves the right to assign, re -assign and substitute its personnel with personnel with comparable qualifications at any time during the term of this Agreement. During the term, and for a period of five (5) years after the termination, of this Agreement, GISNET will not divulge to others any confidential information disclosed by Client to GISNET in writing and clearly marked as confidential (Confidential Information"). Confidential Information will not include any information that is: as of the time of its disclosure, or thereafter becomes, part of the public domain through a source other than GISNET; made known to GISNET by a third person who is not subject to any confidentiality obligation and does not impose any confidentiality obligation on GISNET with respect to such information; independently developed by personnel of GISNET without knowledge of the Confidential Information; Or Required to be disclosed pursuant to governmental authority, law, regulation, duly authorized subpoena or court order, where upon GISNET will provide written notice to Client prior to such disclosure. All notices and other communications required or desired to be given pursuant to this Agreement will be given in writing and will be deemed duly given (i) upon personal delivery; (ii) on the third day after mailing if sent by registered or certified mail, postage prepaid, return receipt requested; (iii) on the day after mailing if sent by a nationally recognized overnight delivery service which maintains records of the time, place and recipient of delivery; or (iv) upon receipt of a confirmed transmission, if sent by telex or facsimile transmission, and in each case if addressed as follows: 2842 NW 79 Ave Doral, Florida 33122 , Fax: (305) 265-0872. GISNET and Client acknowledge and agree that the Additional Terms and Conditions available for review at http://www.gisnetnetiexhibita.cfm as Exhibit A are incorporated into and made a part of this Agreement. Acknowledged and agreed by Client By: Name: Title: Date: Authorized GISNET Representative By: Name: Title: Date: PLEASE SIGN AND FAX BACK TO 305-265-0872 OR EMAIL TO ORDERS@GISNET.NET TO EXECUTE YOUR ORDER. Net Order: 68,253.50 Less Discount: 0.00 Freight: 0.00 Sales Tax: 0.00 Order Total: 68,253.50 2842 NW 79 AVE - Miami, FL 33122 TEL: 305-265-0447 - FAX: 305-265-0872 http://www,gisnet.net „ ... . . gI S f et support@gisnet.net TELECOM CUSTOMER NUMBER: CITYMB PAGE: 1 ORDER NUMBER: 0002656 SALES REP: Felix Veloso ORDER DATE: 9/24/2007 TERMS: NET 10 ACCOUNT CONTACT: ORDER CONTACT: CUSTOMER PO#: SOLD TO: SHIP TO: City of Miami Beach 12TH STREET PARKING GARAGE 1100 Washington Ave 4TH Floor MIAMI BEACH, FL 33139 QUOTE ITEM NUMBER UNIT QUANTITY PRICE AMOUNT WORK TICKET / STEP: 0002656:001:000 STEP DESCRIPTION: ICREALTIME SECURITY EQUIP PROP STATUS: PARTS REQ WORK TICKET / STEP: 0002656:001:001 STEP DESCRIPTION: ICREALTIME SECURITY EQUIP PROP STATUS: PARTS REQ ICR FLEX -16 R30 EACH 2.00 2,024.00 4,048.00 ICREALTIME 16CHANNEL DVR W/ CDRW 1TB HD & 480/480FPS ICR-PIR EACH 2.00 90.00 180.00 COVERT MOTION DETECTOR CAMERA ICR ELEV CORNER EACH 5.00 178.00 890.00 ICREALTIME ELEVATOR CORNER MOUNT CAMERA ICR-10X-DN EACH 2.00 399.00 798.00 10X ZOOM DAY/NIGHT IR CUT FILTER 570TVL ICR-540CC D EACH 12.00 177.00 2,124.00 HIGH RES DAY/NIGHT 540TVL PRO BODY CAM LENS 2.8-12 Al EACH 12.00 64.00 768.00 ICREALTIME 2.8-12MM AUTO IRIS LENS CS MOUNT OUTDOOR HOUSING EACH 12.00 28.00 336.00 ICREALTIME OUTDOOR CAMERA HOUSING M-4 EACH 12.00 12.50 150.00 ICREALTIME LARGE OUTDOOR MOUNT (METAL) ICR 16 CH POWER EACH 2.00 299.00 598.00 16 CHANNEL REGULATED UL POWER SUPPLY 2842 NW 79 AVE - Miami, FL 33122 TEL: 305-265-0447 - FAX: 305-265-0872 http://www.gisnetnet gi s n ez support@gisnet.net TELECOM CUSTOMER NUMBER: CITYMB PAGE: 2 ORDER NUMBER: 0002656 SALES REP: Felix Veloso ORDER DATE: 9/24/2007 TERMS: NET 10 ACCOUNT CONTACT: ORDER CONTACT: CUSTOMER PO#: SOLD TO: SHIP TO: City of Miami Beach 12TH STREET PARKING GARAGE 1100 Washington Ave 4TH Floor MIAMI BEACH, FL 33139 QUOTE ITEM NUMBER UNIT QUANTITY PRICE AMOUNT ED3000RM2U EACH 1.00 1,300.00 1,300.00 MINUTEMAN 3000VA ON-LINE RACKNVALL/TOWER UPS BATTERY BACKUP EDBP72XL EACH 2.00 435.00 870.00 MINUTEMAN EXTERNAL BATTERY PACK FOR ED3000RM2U 11900-724 EACH 1.00 725.00 725.00 CHATSWORTH WALL MOUNT RACK ENCLOSURE 24"H 19"W 24"D BLACK W/ TINTED DOOR. /FIREBACKBOARD EACH 1.00 80.00 80.00 FIRE RETARDANT WOOD BACKBOARD NIDEO-COAXPWR EACH 6.00 125.00 750.00 VIDEO -COAX RG59 SIAMESE POWER (FIRST LEVEL) NIDEO-COAXPWR EACH 5.00 150.00 750.00 VIDEO -COAX RG59 SIAMESE POWER (SECOND LEVEL) /VIDEO-COAXPWR EACH 5.00 175.00 875.00 VIDEO -COAX RG59 SIAMESE POWER (THIRD LEVEL) N1DEO-COAXPWR EACH VIDEO -COAX RG59 SIAMESE POWER (ROOF LEVEL) NIDEO-COAXPWR EACH VIDEO -COAX RG59 SIAMESE POWER (ELEVATOR) /ELECTRICAL EACH COMPLETE EMT CONDUIT RUN FOR CAMERAS /ACCESORIES EACH EXTRA MATERIALS REQUESTED AS PER BID#47-06107 1 CAMERA HOUING OF EACH TYPE 1 POWER SUPPLY OF EACH TYPE 2 CAMERAS OF EACH TYPE 2 LENSES OF EACH TYPE 4.00 200.00 800.00 3.00 150.00 450.00 1.00 30,250.00 30,250.00 1.00 2,155.50 2,155.50 #41A) gisneti TELECOM 2842 NW 79 AVE - Miami, FL 33122 TEL: 305-265-0447 - FAX: 305-265-0872 -http://www.gisnet.net support@gisnet.net CUSTOMER NUMBER: CITYMB ORDER NUMBER: 0002656 ORDER DATE: 9/24/2007 ACCOUNT CONTACT: CUSTOMER PO#: SOLD TO: City of Miami Beach 1100 Washington Ave 4TH Floor MIAMI BEACH, FL 33139 PAGE: 3 SALES REP: Felix Veloso TERMS: NET 10 ORDER CONTACT: SHIP TO: 12TH STREET PARKING GARAGE QUOTE ITEM NUMBER UNIT QUANTITY PRICE AMOUNT /ACCESORIES EACH 1.00 420.00 420.00 MISC ACCESSORIES /INSTALL EACH 70.00 65.00 4,550.00 INSTALLATION SERVICES /LABOR EACH 1.00 780.00 780.00 COMPLETE PROGRAMING OF DVR'S /WARRANTY EACH 1.00 0.00 0.00 THIS QUOTE INCLUDES ONE (1) YEAR PARTS & LABOR ON-SITE WARRANTY LIGHTNING SURGES & ACTS OF GOD ARE NOT COVERED BY WARRANTY. /PERMIT EACH 1.00 500.00 500.00 PERMIT FEES /ITEM EACH SHOP DRAWINGS & AS-BUILTS 1.00 0.00 0.00 2842 NW 79 AVE - Miami, FL 33122 _ TEL: 305-265-0447 - FAX: 305-265-0872 http://www.gisnet.net -- gis n10ez support@gisnet.net TELECOM CUSTOMER NUMBER: CITYMB ORDER NUMBER: 0002656 ORDER DATE: 9/24/2007 ACCOUNT CONTACT: CUSTOMER PO#: SOLD TO: City of Miami Beach 1100 Washington Ave 4TH Floor MIAMI BEACH, FL 33139 ITEM NUMBER QUOTE PAGE: 4 SALES REP: Felix Veloso TERMS: NET 10 ORDER CONTACT: SHIP TO: 12TH STREET PARKING GARAGE UNIT QUANTITY PRICE AMOUNT TERMS AND CONDITIONS This Agreement will become effective on the date signed by GISNET's authorized representative below and continue until terminated by either GISNET or Client at any time, with or without cause, by providing at east thirty (30) days prior written notice to the other party. All fees and expenses related to services provided under this Agreement must be paid by Client to GISNET, in full, prior to termination. This Agreement will not become effective or binding upon GISNET unless signed and dated by a GISNET authorized representative where indicated below. GISNET shall be solely responsible for staffing decisions with respect to its personnel and the performance of services. GISNET reserves the right to assign, re -assign and substitute its personnel with personnel with comparable qualifications at any time during the term of this Agreement. During the term, and for a period of five (5) years after the termination, of this Agreement, GISNET will not divulge to others any confidential information disclosed by Client to GISNET in writing and clearly marked as confidential ("Confidential Information"). Confidential Information will not include any information that is: as of the time of its disclosure, or thereafter becomes, part of the public domain through a source other than GISNET; made known to GISNET by a third person who is not subject to any confidentiality obligation and does not impose any confidentiality obligation on GISNET with respect to such information; independently developed by personnel of GISNET without knowledge of the Confidential Information; or Required to be disclosed pursuant to governmental authority, law, regulation, duly authorized subpoena or court order, where upon GISNET will provide written notice to Client prior to such disclosure. All notices and other communications required or desired to be given pursuant to this Agreement will be given in writing and will be deemed duly given (1) upon personal delivery; (ii) on the third day after mailing if sent by registered or certified mail, postage prepaid, return receipt requested; (iii) on the day after mailing if sent by a nationally recognized overnight delivery service which maintains records of the time, place and recipient of delivery; or (iv) upon receipt of a confirmed transmission, if sent by telex or facsimile transmission, and in each case if addressed as follows: 2842 NW 79 Ave Doral, Florida 33122 , Fax: (305) 265-0872. GISNET and Client acknowledge and agree that the Additional Terms and Conditions available for review at http://www.gisnet.net/exhibita.cfm as Exhibit A are incorporated into and made a part of this Agreement. Acknowledged and agreed by Client By: Name: Title: Date: Authorized GISNET Representative By: Name: Title: Date: PLEASE SIGN AND FAX BACK TO 305-265-0872 OR EMAIL TO ORDERS@GISNET.NET TO EXECUTE YOUR ORDER. Net Order: 55,147.50 Less Discount: 0.00 Freight: 0.00 Sales Tax: 0.00 Order Total: 55,147.50 gisnet TELECOM CUSTOMER NUMBER: CITYMB PAGE: 1 ORDER NUMBER: 0002657 SALES REP: Felix Veloso ORDER DATE: 9/24/2007 TERMS: NET 10 ACCOUNT CONTACT: ORDER CONTACT: 2842 NW 79 AVE - Miami, FL 33122 TEL: 305-265-0447 - FAX: 305-265-0872 •http://www: g isnet. net support@gisnet.net QUOTE CUSTOMER PO#: SOLD TO: City of Miami Beach 1100 Washington Ave 4TH Floor MIAMI BEACH, FL 33139 ITEM NUMBER SHIP TO: 13TH STREET PARKING GARAGE UNIT QUANTITY PRICE AMOUNT WORK TICKET / STEP: 0002657:001:000 STEP DESCRIPTION: ICREALTIME SECURITY EQUIP PROP STATUS: PARTS REQ WORK TICKET / STEP: 0002657:001:001 STEP DESCRIPTION: ICREALTIME SECURITY EQUIP PROP STATUS: PARTS REQ ICR FLEX -16 R30 EACH 2.00 2,024.00 ICREALTIME 16CHANNEL DVR W/ CDRW ITB HD & 480/480FPS 4,048.00 ICR-PIR EACH 2.00 90.00 180.00 COVERT MOTION DETECTOR CAMERA ICR ELEV CORNER EACH 11.00 178.00 1,958.00 ICREALTIME ELEVATOR CORNER MOUNT CAMERA ICR-10X-DN EACH 2.00 399.00 798.00 10X ZOOM DAY/NIGHT IR CUT FILTER 570TVL ICR-540C C D EACH 9.00 177.00 1,593.00 HIGH RES DAY/NIGHT 540TVL PRO BODY CAM LENS 2.8-12 Al EACH 9.00 64.00 576.00 ICREALTIME 2.8-12MM AUTO IRIS LENS CS MOUNT OUTDOOR HOUSING EACH 9.00 28.00 252.00 ICREALTIME OUTDOOR CAMERA HOUSING M-4 EACH 9.00 12.50 112.50 ICREALTIME LARGE OUTDOOR MOUNT (METAL) ICR 16 CH POWER EACH 2.00 299.00 598.00 16 CHANNEL REGULATED UL POWER SUPPLY #4.11k gisnet TELECOM CUSTOMER NUMBER: CITYMB ORDER NUMBER: 0002657 ORDER DATE: 9/24/2007 ACCOUNT CONTACT: CUSTOMER PO#: SOLD TO: City of Miami Beach 1100 Washington Ave 4TH Floor MIAMI BEACH, FL 33139 2842 NW 79 AVE - Miami, FL 33122 TEL: 305-265-0447 - FAX: 305-265-0872 http://www.gisnet.net support@gisnet.net PAGE: 2 SALES REP: Felix Veloso TERMS: NET 10 ORDER CONTACT: SHIP TO: 13TH STREET PARKING GARAGE QUOTE ITEM NUMBER UNIT QUANTITY PRICE AMOUNT ED3000RM2U EACH 1.00 1,300.00 1,300.00 MINUTEMAN 3000VA ON-LINE RACK/WALL/TOWER UPS BATTERY BACKUP EDBP72XL EACH 2.00 435.00 870.00 MINUTEMAN EXTERNAL BATTERY PACK FOR ED3000RM2U 11900-724 EACH 1.00 725.00 725.00 CHATSWORTH WALL MOUNT RACK ENCLOSURE 24"H 19"W 24"D BLACK W/ TINTED DOOR. /F I REBACKBOARD EACH 1.00 80.00 80.00 FIRE RETARDANT WOOD BACKBOARD NIDEO-COAXPWR EACH 8.00 125.00 1,000.00 VIDEO -COAX RG59 SIAMESE POWER (FIRST LEVEL) NIDEO-COAXPWR EACH 4.00 150.00 600.00 VIDEO -COAX RG59 SIAMESE POWER (SECOND LEVEL) NIDEO-COAXPWR EACH 4.00 175.00 700.00 VIDEO -COAX RG59 SIAMESE POWER (THIRD LEVEL) NIDEO-COAXPWR EACH 4.00 200.00 800.00 VIDEO -COAX RG59 SIAMESE POWER (FOURTH LEVEL) NIDEO-COAXPWR EACH 4.00 250.00 1,000.00 VIDEO -COAX RG59 SIAMESE POWER (ROOF LEVEL) NIDEO-COAXPWR EACH 2.00 150.00 300.00 VIDEO -COAX RG59 SIAMESE POWER (ELEVATOR) /ELECTRICAL EACH 1.00 29,645.00 29,645.00 COMPLETE EMT CONDUIT RUN FOR CAMERAS /ACCESORIES EACH 1.00 2,155.50 2,155.50 &felt gisnet TELECOM 2842 NW 79 AVE - Miami, FL 33122 TEL: 000-2ss-044r'FAX: oos-2ss:0a72 »ttp://w^mvgisnn.mm evpport@o|onetom CUSTOMER NUMBER: COYMB PAGE: 3 ORDER NUMBER: 0002057 SALES REP: Felix Veloso ORDER DATE: 8/24/2007 TERMS: NET 10 ACCOUNT CONTACT: ORDER CONTACT: CUSTOMER PO#: SOLD TO: SHIP TO: City of Miami Beach I3TH STREET PARKING GARAGE 1100 Washington Ave 4TH Floor MIAMI BEACH, FL 33139 ITEM NUMBER QUOTE _ UNIT QUANTITY PRICE AMOUNT EXTRA MATERIALS REQUESTED AS PER BID#47-06/07 1 CAMERA HOUNG OF EACH TYPE 1POWER SUPPLY OFEACH TYPE 2 CAMERAS OF EACH TYPE 2 LENSES OF EACH TYPE /ACCESORIES EACH 1.00 520l0 520D0 MISC ACCESSORIES /INSTALL EACH 75.00 65.00 4.875.00 INSTALLATION SERVICES COMPLETE INSTALLATION & PROGRAMING OF 2 GE 16CHANNEL DVR'S. COMPLETE INSTALLATION MOUNTING, POINTING & FOCUSING OF 2 PIR CAMERAS. COMPLETE INSTALLATION MOUNTING & FOCUSNG OF 11 CORNER MOUNT CAMERAS. COMPLETE INSTALLATION MOUNTING, POINTING & FOCUSING OF 2 LICENCE PLATE CAMERAS. COMPLETE INSTALLATION MOUNTING, POINTING & FOCUSING OF 9 FIXED BOX CAMERAS. COMPLETE INSTALLATION & MOUNTING OF 2 16CHANNEL POWER SUPPLY UNITS FOR CAMERA VOLTAGE. /LABOR EACH 1.00 780.00 780.00 COMPLETE PROGRAMING OF DVR'S /WARRANTY EACH 1.00 0.00 0.00 THIS QUOTE INCLUDES ONE (1) YEAR PARTS & LABOR ON-SITE WARRANTY LIGHTNING SURGES & ACTS OF GOD ARE NOT COVERED BY WARRANTY. /PERMIT EACH 1.00 50.00 500.00 PERMIT FEES /ITEM EACH 1.00 0.00 0.00 SHOP DRAWINGS &AS'8U|LTS 2842 NW 79 AVE - Miami, FL 33122 TEL: 305-265-0447 - FAX: 305-265-0872 http://www:gisnet.net gis n et support@gisnet.net TELECOM CUSTOMER NUMBER: CITYMB PAGE: 4 ORDER NUMBER: 0002657 SALES REP: Felix Veloso ORDER DATE: 9/24/2007 TERMS: NET 10 ACCOUNT CONTACT: ORDER CONTACT: CUSTOMER PO#: SOLD TO: City of Miami Beach 1100 Washington Ave 4TH Floor MIAMI BEACH, FL 33139 ITEM NUMBER SHIP TO: 13TH STREET PARKING GARAGE UNIT QUANTITY PRICE TERMS AND CONDITIONS QUOTE AMOUNT This Agreement will become effective on the date signed by GISNET's authorized representative below and continue until terminated by either GISNET or Client at any time, with or without cause, by providing at east thirty (30) days prior written notice to the other party. All fees and expenses related to services provided under this Agreement must be paid by Client to GISNET, in full, prior to termination. This Agreement will not become effective or binding upon GISNET unless signed and dated by a GISNET authorized representative where indicated below. GISNET shall be solely responsible for staffing decisions with respect to its personnel and the performance of services. GISNET reserves the right to assign, re -assign and substitute its personnel with personnel with comparable qualifications at any time during the term of this Agreement. During the term, and for a period of five (5) years after the termination, of this Agreement, GISNET will not divulge to others any confidential information disclosed by Client to GISNET in writing and clearly marked as confidential ("Confidential Information"). Confidential Information will not include any information that is: as of the time of its disclosure, or thereafter becomes, part of the public domain through a source other than GISNET; made known to GISNET by a third person who is not subject to any confidentiality obligation and does not impose any confidentiality obligation on GISNET with respect to such information; independently developed by personnel of GISNET without knowledge of the Confidential Information; or • Required to be disclosed pursuant to governmental authority, law, regulation, duly authorized subpoena or court order, where upon GISNET will provide written notice to Client prior to such disclosure. All notices and other communications required or desired to be given pursuant to this Agreement will be given in writing and will be deemed duly given (i) upon personal delivery; (ii) on the third day after mailing if sent by registered or certified mail, postage prepaid, return receipt requested; (iii) on the day after mailing if sent by a nationally recognized overnight delivery service which maintains records of the time, place and recipient of delivery; or (iv) upon receipt of a confirmed transmission, if sent by telex or facsimile transmission, and in each case if addressed as follows: 2842 NW 79 Ave Doral, Florida 33122 , Fax: (305) 265-0872. GISNET and Client acknowledge and agree that the Additional Terms and Conditions available for review at http://www.gisnet.net/exhibita.cfm as Exhibit A are incorporated into and made a part of this Agreement. Acknowledged and agreed by Client Authorized GISNET Representative By: Name: Title: Date: By: Name: Title: Date: PLEASE SIGN AND FAX BACK TO 305-265-0872 OR EMAIL TO ORDERS@GISNET.NET TO EXECUTE YOUR ORDER. Net Order: 55,966.00 Less Discount: 0.00 Freight: 0.00 Sales Tax: 0.00 Order Total: 55,966.00 g isnet TELECOM 2842 NW 79 AVE - Miami, FL 33122 TEL: 305-265-0447 - FAX: 305-265-0872 http://www.gisnet.net support@gisnet.net CUSTOMER NUMBER: CITYMB ORDER NUMBER: 0002658 ORDER DATE: 9/24/2007 ACCOUNT CONTACT: CUSTOMER PO#: SOLD TO: City of Miami Beach 1100 Washington Ave 4TH Floor MIAMI BEACH, FL 33139 ITEM NUMBER QUOTE PAGE: 1 SALES REP: Felix Veloso TERMS: NET 10 ORDER CONTACT: SHIP TO: 16TH STREET PARKING GARAGE UNIT QUANTITY PRICE AMOUNT WORK TICKET / STEP: 0002658:001:000 STEP DESCRIPTION: ICREALTIME SECURITY EQUIP PROP STATUS: PARTS REQ WORK TICKET / STEP: 0002658:001:001 STEP DESCRIPTION: ICREALTIME SECURITY EQUIP PROP STATUS: PARTS REQ ICR FLEX -16 R30 EACH 4.00 2,024.00 ICREALTIME 16CHANNEL DVR W/ CDRW 1TB HD & 480/480FPS 8,096.00 ICR-PIR EACH 4.00 90.00 360.00 COVERT MOTION DETECTOR CAMERA ICR ELEV CORNER EACH 15.00 178.00 2,670.00 ICREALTIME ELEVATOR CORNER MOUNT CAMERA ICR-10X-DN EACH 4.00 399.00 1,596.00 10X ZOOM DAY/NIGHT IR CUT FILTER 57OTVL ICR-540CCD EACH 31.00 175.00 5,425.00 HIGH RES DAY/NIGHT 540TVL PRO BODY CAM LENS 2.8-12 Al EACH 31.00 64.00 1,984.00 ICREALTIME 2.8-12MM AUTO IRIS LENS CS MOUNT OUTDOOR HOUSING EACH 31.00 28.00 868.00 ICREALTIME OUTDOOR CAMERA HOUSING M-4 EACH 31.00 12.50 387.50 ICREALTIME LARGE OUTDOOR MOUNT (METAL) ICR 16 CH POWER EACH 4.00 299.00 1,196.00 16 CHANNEL REGULATED UL POWER SUPPLY gisnet TELECOM CUSTOMER NUMBER: ORDER NUMBER: 2842 NW 79 AVE - Miami, FL 33122 TEL: 305-265-0447 - FAX: 305-265-0872 http://www.gisnet. net support@gisnet.net CITYMB PAGE: 2 0002658 SALES REP: Felix Veloso ORDER DATE: 9/24/2007 TERMS: NET 10 ACCOUNT CONTACT: ORDER CONTACT: CUSTOMER PO#: SOLD TO: City of Miami Beach 1100 Washington Ave 4TH Floor MIAMI BEACH, FL 33139 SHIP TO: 16TH STREET PARKING GARAGE UQTE ITEM NUMBER UNIT QUANTITY PRICE AMOUNT ED3000RM2U EACH 1.00 1,300.00 1,300.00 MINUTEMAN 3000VA ON-LINE RACK/WALL/TOWER UPS BATTERY BACKUP EDBP72XL EACH 2.00 435.00 870.00 MINUTEMAN EXTERNAL BATTERY PACK FOR ED3000RM2U E2000RM2U EACH 1.00 885.00 885.00 2000VA LINE ENTERACTIVE RACK/WALL/TOWER UPS BATTERY BACKUP EBP72XL EACH 2.00 445.00 890.00 EXTERNAL BATTERY PACK FOR THE E2000RM2U 11900-724 EACH 1.00 725.00 725.00 CHATSWORTH WALL MOUNT RACK ENCLOSURE 24"H 19"W 24"D BLACK W/ TINTED DOOR. /FIREBACKBOARD EACH 1.00 80.00 80.00 FIRE RETARDANT WOOD BACKBOARD NIDEO-COAXPWR EACH 14.00 125.00 1,750.00 VIDEO -COAX RG59 SIAMESE POWER (FIRST LEVEL) VIDEO-COAXPWR EACH 10.00 150.00 1,500.00 VIDEO -COAX RG59 SIAMESE POWER (SECOND LEVEL) /VIDEO-COAXPWR EACH 9.00 175.00 1,575.00 VIDEO -COAX RG59 SIAMESE POWER (THIRD LEVEL) NIDEO-COAXPWR EACH 9.00 200.00 1,800.00 VIDEO -COAX RG59 SIAMESE POWER (FOURTH LEVEL) NIDEO-COAXPWR EACH 9.00 225.00 2,025.00 VIDEO -COAX RG59 SIAMESE POWER (FIFTH LEVEL) NIDEO-COAXPWR EACH 4.00 250.00 1,000.00 VIDEO -COAX RG59 SIAMESE POWER (ROOF LEVEL) NIDEO-COAXPWR EACH VIDEO -COAX RG59 SIAMESE POWER (ELEVATOR) 3.00 150.00 450.00 [Olt gisnet TELECOM CUSTOMER NUMBER: CITYMB ORDER NUMBER: 0002658 ORDER DATE: 9/24/2007 ACCOUNT CONTACT: 2842 NW 79 AVE - Miami, FL 33122 TEL: 305-265-0447 FAX: 305-265-0872 http:7/www.gisnet.net support©gisnet.net CUSTOMER PO#: SOLD TO: City of Miami Beach 1100 Washington Ave 4TH Floor MIAMI BEACH, • FL 33139 PAGE: 3 SALES REP: Felix Veloso TERMS: NET 10 ORDER CONTACT: SHIP TO: 16TH STREET PARKING GARAGE QUOTE ITEM NUMBER UNIT QUANTITY PRICE AMOUNT /ELECTRICAL EACH 1.00 39,963.00 39,963.00 COMPLETE EMT CONDUIT RUN FOR CAMERAS /ACCESORIES EACH 1.00 2,155.50 2,155.50 EXTRA MATERIALS REQUESTED AS PER BID#47-06/07 1 CAMERA HOUSING OF EACH TYPE 1 POWER SUPPLY OF EACH TYPE 2 CAMERAS OF EACH TYPE 2 LENSES OF EACH TYPE /ACCESORIES EACH 1.00 1,140.00 1,140.00 MISC ACCESSORIES /INSTALL EACH 154.00 65.00 10,010.00 INSTALLATION SERVICES COMPLETE INSTALLATION & PROGRAMING OF 4 GE 16CHANNEL DVR'S. COMPLETE INSTALLATION MOUNTING, POINTING & FOCUSING OF 4 PIR CAMERAS. COMPLETE INSTALLATION MOUNTING & FOCUSING OF 15 CORNER MOUNT CAMERAS. COMPLETE INSTALLATION MOUNTING, POINTING & FOCUSING OF 4 LICENCE PLATE CAMERAS. COMPLETE INSTALLATION MOUNTING, POINTING & FOCUSING OF 31 FIXED BOX CAMERAS. COMPLETE INSTALLATION & MOUNTING OF 4 16CHANNEL POWER SUPPLY UNITS FOR CAMERA VOLTAGE. /LABOR EACH 1.00 1,560.00 1,560.00 COMPLETE PROGRAMING OF DVR'S /WARRANTY EACH 1.00 0.00 0.00 THIS QUOTE INCLUDES ONE (1) YEAR PARTS & LABOR ON-SITE WARRANTY LIGHTNING SURGES & ACTS OF GOD ARE NOT COVERED BY WARRANTY. /PERMIT PERMIT FEES EACH 1.00 500.00 /ITEM EACH SHOP DRAWINGS & AS-BUILTS 1.00 0.00 500.00 0.00 2842 NW 79 AVE - Miami, FL 33122 TEL: 305-265-0447 - FAX: 305-265-0872 http://www.gisnetnet gis n et support@gisnetnet TELECOM CUSTOMER NUMBER: CITYMB PAGE: 4 ORDER NUMBER: 0002658 SALES REP: Felix Veloso ORDER DATE: 9/24/2007 TERMS: NET 10 ACCOUNT CONTACT: ORDER CONTACT: CUSTOMER PO#: SOLD TO: City of Miami Beach 1100 Washington Ave 4TH Floor MIAMI BEACH, FL 33139 SHIP TO: 16TH STREET PARKING GARAGE QUOTE ITEM NUMBER UNIT QUANTITY PRICE AMOUNT gisnet TELECOM 2842 NW 79 AVE - Miami, FL 33122 TEL: 305-265-0447 - FAX: 305-265-0872 http://www.gisnetnet support@gisnet,net CUSTOMER NUMBER: CITYMB ORDER NUMBER: 0002658 ORDER DATE: 9/24/2007 ACCOUNT CONTACT: CUSTOMER PO#: SOLD TO: City of Miami Beach 1100 Washington Ave 4TH Floor MIAMI BEACH, FL 33139 ITEM NUMBER QUOTE PAGE: 5 SALES REP: Felix Veloso TERMS: NET 10 ORDER CONTACT: SHIP TO: 16TH STREET PARKING GARAGE UNIT QUANTITY PRICE AMOUNT TERMS AND CONDITIONS This Agreement will become effective on the date signed by GISNET's authorized representative below and continue until terminated by either GISNET or Client at any time, with or without cause, by providing at east thirty (30) days prior written notice to the other party. All fees and expenses related to services provided under this Agreement must be paid by Client to GISNET, in full, prior to termination. This Agreement will not become effective or binding upon GISNET unless signed and dated by a GISNET authorized representative where indicated below. GISNET shall be solely responsible for staffing decisions with respect to its personnel and the performance of services. GISNET reserves the right to assign, re -assign and substitute its personnel with personnel with comparable qualifications at any time during the term of this Agreement. During the term, and for a period of five (5) years after the termination, of this Agreement, GISNET will not divulge to others any confidential information disclosed by Client to GISNET in writing and clearly marked as confidential ("Confidential Information"). Confidential Information will not include any information that is: as of the time of its disclosure, or thereafter becomes, part of the public domain through a source other than GISNET; made known to GISNET by a third person who is not subject to any confidentiality obligation and does not impose any confidentiality obligation on GISNET with respect to such information; independently developed by personnel of GISNET without knowledge of the Confidential Information; or Required to be disclosed pursuant to governmental authority, law, regulation, duly authorized subpoena or court order, where upon GISNET will provide written notice to Client prior to such disclosure. All notices and other communications required or desired to be given pursuant to this Agreement will be given in writing and will be deemed duly given (i) upon personal delivery; (ii) on the third day after mailing if sent by registered or certified mail, postage prepaid, return receipt requested; (iii) on the day after mailing if sent by a nationally recognized overnight delivery service which maintains records of the time, place and recipient of delivery; or (iv) upon receipt of a confirmed transmission, if sent by telex or facsimile transmission, and in each case if addressed as follows: 2842 NW 79 Ave Doral, Florida 33122 , Fax: (305) 265-0872. GISNET and Client acknowledge and agree that the Additional Terms and Conditions available for rev Exhibit A are incorporated into and made a part of this Agreement. Acknowledged and agreed by Client By: Name: Title: Date: at http://www.gisnet.net/exhibita.cfm as Authorized GISNET Representative By: Name: Title: Date: PLEASE SIGN AND FAX BACK TO 305-265-0872 OR EMAIL TO ORDERS@GISNET.NET TO EXECUTE YOUR ORDER. Net Order: 92,761.00 Less Discount: 0.00 Freight: 0.00 Sales Tax: 0.00 Order Total: 92,761.00 gisnet TELECOM 2842 NW 79 AVE - Miami, FL 33122 TEL: 305-265-0447 - FAX: 305-265-0872 http://www. gis net. net support@gisnet.net CUSTOMER NUMBER: ORDER NUMBER: ORDER DATE: ACCOUNT CONTACT: CITYMB 0002659 9/24/2007 CUSTOMER PO#: SOLD TO: City of Miami Beach 1100 Washington Ave 4TH Floor MIAMI BEACH, FL 33139 ITEM NUMBER UNIT QUANTITY PAGE: 1 SALES REP: Felix Veloso TERMS: NET 10 ORDER CONTACT: SHIP TO: 42ND STREET PARKING GARAGE PRICE WORK TICKET / STEP: 0002659:001:000 STEP DESCRIPTION: ICREALTIME SECURITY EQUIP PROP STATUS: PARTS REQ WORK TICKET / STEP: 0002659:001:001 STEP DESCRIPTION: ICREALTIME STATUS: PARTS REQ ICR FLEX -16 R30 EACH 3.00 ICREALTIME 16CHANNEL DVR W/ CDRW ITB HD & 480/480FPS ICR-PIR EACH COVERT MOTION DETECTOR CAMERA ICR ELEV CORNER EACH ICREALTIME ELEVATOR CORNER MOUNT CAMERA ICR-10X-DN EACH 10X ZOOM DAY/NIGHT IR CUT FILTER 570TVL ICR-540CCD EACH HIGH RES DAY/NIGHT 540TVL PRO BODY CAM LENS 2.8-12 Al EACH ICREALTIME 2.8-12MM AUTO IRIS LENS CS MOUNT OUTDOOR HOUSING EACH ICREALTIME OUTDOOR CAMERA HOUSING M-4 EACH ICREALTIME LARGE OUTDOOR MOUNT (METAL) ICR 16 CH POWER EACH 16 CHANNEL REGULATED UL POWER SUPPLY 4.00 12.00 4.00 18.00 18.00 18.00 18.00 3.00 SECURITY EQUIP PROP 2,024.00 90.00 178.00 399.00 175.00 64.00 28.00 12.50 299.00 QUOTE_ AMOUNT 6,072.00 360.00 2,136.00 1,596.00 3,150.00 1,152.00 504.00 225.00 897.00 2842 NW 79 AVE - Miami, FL 33122 TEL: 305-265-0447 - FAX: -305-265-0872 http://www.gisnet.net - gisnerIA14-support@gisnet.net TELECOM CUSTOMER NUMBER: CITYMB PAGE: 2 ORDER NUMBER: 0002659 SALES REP: Felix Veloso ORDER DATE: 9/24/2007 TERMS: NET 10 ACCOUNT CONTACT: ORDER CONTACT: CUSTOMER PO#: SOLD TO: SHIP TO: City of Miami Beach 1100 Washington Ave 4TH Floor MIAMI BEACH, FL 33139 42ND STREET PARKING GARAGE QUOTE ITEM NUMBER UNIT QUANTITY PRICE AMOUNT ED3000RM2U EACH 1.00 1,300.00 1,300.00 MINUTEMAN 3000VA ON-LINE RACK/WALL/TOWER UPS BATTERY BACKUP EDBP72XL EACH 2.00 435.00 870.00 MINUTEMAN EXTERNAL BATTERY PACK FOR ED3000RM2U E2000RM2U EACH 1.00 885.00 885.00 2000VA LINE ENTERACTIVE RACK/WALL/TOWER UPS BATTERY BACKUP EBP72XL EACH 2.00 445.00 890.00 EXTERNAL BATTERY PACK FOR THE E2000RM2U 11900-724 EACH 1.00 725.00 725.00 CHATSWORTH WALL MOUNT RACK ENCLOSURE 24"H 19"W 24"D BLACK W/ TINTED DOOR. /FIREBACKBOARD EACH 1.00 80.00 80.00 FIRE RETARDANT WOOD BACKBOARD Nl DEO-COAXPW R EACH 14.00 125.00 1,750.00 VIDEO -COAX RG59 SIAMESE POWER (FIRST LEVEL) NIDEO-COAXPWR EACH 6.00 150.00 900.00 VIDEO -COAX RG59 SIAMESE POWER (SECOND LEVEL) NIDEO-COAXPWR EACH 6.00 175.00 1,050.00 VIDEO -COAX RG59 SIAMESE POWER (THIRD LEVEL) /VIDEO-COAXPWR EACH 6.00 200.00 1,200.00 VIDEO -COAX RG59 SIAMESE POWER (FOURTH LEVEL) NI DEO-COAXPW R EACH 4.00 225.00 900.00 VIDEO -COAX RG59 SIAMESE POWER (ROOF LEVEL) /VIDEO-COAXPWR EACH 2.00 150.00 300.00 VIDEO -COAX RG59 SIAMESE POWER (ELEVATORS) /ELECTRICAL EACH COMPLETE EMT CONDUIT RUN FOR CAMERAS 1.00 39, 547.00 39,547.00 2842 NW ��iFLomou TEL: 305-265-0447 FAX: 305-265-0872 —�met support@gisnetnet TELECOM CUSTOMER NUMBER: CITYMB PAGE: 3 ORDER NUMBER: 0002658 SALES REP: FelixValoeo ORDER DATE: 3/24/2807 TERMS: NET 10 ACCOUNT CONTACT: ORDER CONTACT: CUSTOMER PO#: SOLD TO: City of Miami Beach 42ND STREET PARKING GARAGE 1100 Washington Ave 4TH Floor MIAMI BEACH, FL 33139 SHIP TO: ITEM NUMBER - UNIT QUANTITY PRICE AMOUNT /ACCESORIES EACH EXTRA MATERIALS REQUESTED AS PER BID#47-06/07 1 CAMERA HOUING OF EACH TYPE 1 POWER SUPPLY OF EACH TYPE 2 CAMERAS OF EACH TYPE 2 LENSES OF EACH TYPE /ACCESORIES MISC ACCESSORIES EACH /INSTALL EACH INSTALLATION SERVICES COMPLETE INSTALLATION & PROGRAMING OF3GE1GCHANNELDVR'G. COMPLETE INSTALLATION MOUNTING, POINTING & FOCUSING OF 4 PIR CAMERAS. COMPLETE INSTALLATION MOUNTING & FOCUSING OF 12 CORNER MOUNT CAMERAS. COMPLETE INSTALLATION MOUNTING, POINTING & FOCUSING OF 4 LICENCE PLATE CAMERAS. COMPLETE INSTALLATION MOUNTING, POINTING & FOCUSING OF 18 FIXED BOX CAMERAS. COMPLETE INSTALLATION & MOUNTING OF 3 16CHANNEL POWER SUPPLY UNITS FOR CAMERA VOLTAGE. 1.00 2,155.50 2,155.50 1.00 760.00 760.00 106I0 65.00 6,890.00 /LABOR EACH 1.00 1.170.00 1.178.00 COMPLETE PROGRAMING OF DVR'S /WARRANTY EACH 1.00 0.00 0.00 THIS QUOTE NCLUDES ONE (1) YEAR PARTS & LABOR ON-SITE WARRANTY LIGHTNING SURGES & ACTS OF GOD ARE NOT COVERED BY WARRANTY. /PERMIT EACH 1.00 500.00 500.00 PERMIT FEES /ITEM EACH SHOP DRAWINGS & AS-BUILTS 1.00 0I0 0.00 gisnet TELECOM CUSTOMER NUMBER: CITYMB PAGE: 4 ORDER NUMBER: 0002659 SALES REP: Felix Veloso ORDER DATE: 9/24/2007 TERMS: NET 10 ACCOUNT CONTACT: ORDER CONTACT: 2842 NW 79 AVE -.Miami, FL 33122 TEL: 305-265-0447 - FAX: 305-265-0872 http://www.gisnet.net support@gisnet.net CUSTOMER PO#: SOLD TO: City of Miami Beach 1100 Washington Ave 4TH Floor MIAMI BEACH, FL 33139 SHIP TO: 42ND STREET PARKING GARAGE QUOTE ITEM NUMBER UNIT QUANTITY PRICE AMOUNT TERMS AND CONDITIONS This Agreement will become effective on the date signed by GISNET's authorized representative below and continue until terminated by either GISNET or Client at any time, with or without cause, by providing at east thirty (30) days prior written notice to the other party. All fees and expenses related to services provided under this Agreement must be paid by Client to GISNET, in full, prior to termination. This Agreement will not become effective or binding upon GISNET unless signed and dated by a GISNET authorized representative where indicated below. GISNET shall be solely responsible for staffing decisions with respect to its personnel and the performance of services. GISNET reserves the right to assign, re -assign and substitute its personnel with personnel with comparable qualifications at any time during the term of this Agreement. During the term, and for a period of five (5) years after the termination, of this Agreement, GISNET will not divulge to others any confidential information disclosed by Client to GISNET in writing and clearly marked as confidential ("Confidential Information"). Confidential Information will not include any information that is: as of the time of its disclosure, or thereafter becomes, part of the public domain through a source other than GISNET; made known to GISNET by a third person who is not subject to any confidentiality obligation and does not impose any confidentiality obligation on GISNET with respect to such information; independently developed by personnel of GISNET without knowledge of the Confidential Information; or • Required to be disclosed pursuant to governmental authority, law, regulation, duly authorized subpoena or court order, where upon GISNET will provide written notice to Client prior to such disclosure. All notices and other communications required or desired to be given pursuant to this Agreement will be given in writing and will be deemed duly given (i) upon personal delivery; (ii) on the third day after mailing if sent by registered or certified mail, postage prepaid, return receipt requested; (iii) on the day after mailing if sent by a nationally recognized overnight delivery service which maintains records of the time, place and recipient of delivery; or (iv) upon receipt of a confirmed transmission, if sent by telex or facsimile transmission, and in each case if addressed as follows: 2842 NW 79 Ave Doral, Florida 33122 , Fax: (305) 265-0872. GISNET and Client acknowledge and agree that the Additional Terms and Conditions available for review at http://www.gisnet.net/exhibita.cfm as Exhibit A are incorporated into and made a part of this Agreement. Acknowledged and agreed by Client Authorized GISNET Representative By: Name: Title: Date: By: Name: Title: Date: PLEASE SIGN AND FAX BACK TO 305-265-0872 OR EMAIL TO ORDERS@GISNET.NET TO EXECUTE YOUR ORDER. Net Order: 77,964.50 Less Discount: 0.00 Freight: 0.00 Sales Tax: 0.00 Order Total: 77,964.50 Specifications: 540 TVL 1/3" Sony SS1 Super HAD CCD 12VDC/24VAC Dual Voltage ( ICR-540CCD only ) 3.8mm-9.5mm (outdoor dome)Varifocal Auto Iris Lens 2.5mm-6.0mm (indoor dome)Varifocal Auto Iris Lens True Mechanical Day/Night Feature • Lux Rating — 03 (Color), 0.1 (B&W), 0.002(D/N Sens. Up) 0.002 LUX IN FULL COLOR!! On Screen Display! Spot monitor output Motion Detection Super DNR Mirror Function Privacy Function 50dB S/N ration Super BLC (WDR Like) And much more!! CE FC :s:. •I Lim 1 ,700i,. i Description This camera is perfect for applications in which there is little or no light and high resolution can not be sacrificed. It is an excellent choice for license plate recognition as well as facial identification. When quality cannot be compromised this is the camera of choice. The ICR 10X day/night comes with 33 long range IR's as well as a filter changeable day/night shutter. Rolling IR Cut Filter Main Features: -10X optical zoom (3.8mm wide to 38mm tele) 8X digital zoom -Remote Control W/spot monitor out (for easy set up and access to menu) -True rolling day/night shutter -33 pcs IR -LED -Excellent auto tracking white balance& color rolling suppression -Multi OSD function (on screen display) -DNR (digital noise reduction) increases DVR disk space up 70 7. -High resolution 500 TV Lines color and 570 B/W -Privacy Zone Masking (4 programmable zones per screen) -Mirror Function (flips image) -Weather Proof (IP 65) REALTIME Security So[4 tIcfl IC Realtime, 1 866 997 9009 5811 North Andrews Way 1 954 827 5900 Fort Lauderdale, info @icrealtime. com Florida 33309 www.icrealtime.com Digital Video Recor. SPECIFICATION Main Board Processor Operating System Video Input Audio Input Video Output Audio Output Video Output Display Video Standard System Resources Image Resolution Image Compression Audio Compression Image Quality Video Recording Speed Data Flux Motion Detection Hard Disk Alarm Input Alarm Output Network Interface PTZ Control USB Interface CD Burner Power Supply Power Consumption Case Weight Operation Environment .New 31.3C Se'ieo 4/8/16 R30 DVR Series AMD SC1200/266 Multi -Medio Processor Embedded UNUX 4/8/16 CH Composite BNC NTSC/PAL 1.0 VP•P 750M 4/8/16 CH Audio BNC 200.3000mV 30k Ohm 2 Channel Composite BNC (NTSC/PAL) 1.0Vp•p 75 Ohms 1 CH VGA (Computer Monitor) 4 -port Matrix output 1 CH Audio BNC 200.3000mV 30k Ohm 1, 4, 9, 16 Screen NTSC 1525 Line, 60 Field Per Second), PAL 1625 Line, 50 Field Per Second) Triplex Action: Recording, Replay, Network Access Simultoneously Live View: (NTSC 704x480. PAL 704x576) Recording/Playback: D1 (NTSC 704x480. PAL 704x576) MPEG - 4/H.264 ADPCM 6 Levels Adjustable Per Channel Realtime, NTSC 1 to 30 FPS Adjustable, PAL 1 to 25 FPS Adjustable Per Channel Audio: ADPCM 14.4MB/Hour; Video: 56-900MB/Hour Configurable Per Channel; 192 Defective Areas; Multiple Sensitivity Levels 8 & 16 Channel (Internal 4 IDE Ports, Up To 8 large Size Hard Disks) 8 Channel Alarm Input (External +5v -+15v DC Power Input) 3 Channel Reloy Switch Alarm Outputs R145 10M/100M Auto RS485, RS232 2 USB1.1 Ports (Front & Back); Compatible with USB Mouse, U -Drive, USB Hard Drive Built-in Sony 52x48x24 CD -R, RW Drive (Upgradable lo DVD -RW) 110V 410% 60Hz; 220V +/-20% 50 Hz 43W (Without HD) Only Industrial Standard 2U Metal Case; Rack Mountable 11 Kg (25 Ib) without HD Temp:-I4F-+I30F; Humidity: 10%-90%, Pressure. 86kpo-106kpo 'Fgdud appeormtce mrd specikcations:nre sobjerhto char ° without prior notice. Features: « Embedded Linux OS • Mpeg4/H.264 « Triplex Operation • Synchronized AN • 120/240/480 FPS Recording NTS( • Up to D1 RecordingNiewing « 4 -Port Matrix Output • Internal Disk Redundancy • Up to 4 TB Internal • USB Mouse Interface • Supports External Raid Storage / up to 12 additional hard drives DVR 4/8/16 R30 Graphic User Interface • Informative. Intuitive Menu • Easy t0 Use USB Mouse • Direct and Fos' Response • 4 Ways of Access to the Menu Remote Access over Internet • Direct Web Access using IE Browser < live Vies, Playback, Configutntion Remole.ly • Viewing Multiple (nnteas (11011(e • User/Camera iissonntion for Privacy Protection Audio • Audio/Video Synchronized Recording • Remote Audio Monitoring • iwm Way Audit through DVI; Rentmely Back-up - Flexible Multiple Back-up Mechanism:: • Built in CD Burner j0: Direct Back -un • Support USB Storage Device Backup • Download Video Ai,dro file, in PC xriIrA :External dimeniion 1-• gisnet TELECOM CUSTOMER NUMBER: CITYMB ORDER NUMBER: 0002796 ORDER DATE: 11/7/2007 ACCOUNT CONTACT: CUSTOMER PO#: SOLD TO: City of Miami Beach 1100 Washington Ave 4TH Floor MIAMI BEACH, FL 33139 2842 NW 79 AVE - Miami, FL 33122 TEL: 305-265-0447 - FAX: 305-265-0872 http://www.gisnet.net support@gisnet.net ITEM NUMBER QUOTE PAGE: 1 SALES REP: Felix Veloso TERMS: NET 10 ORDER CONTACT: SHIP TO: City of Miami Beach 1100 Washington Ave 4TH Floor MIAMI BEACH, FL 33139 UNIT QUANTITY PRICE AMOUNT WORK TICKET / STEP: 0002796:001:000 STEP DESCRIPTION: TWO (2) YEAR EXTENDED WARRANTY STATUS: COMPLETED WORK TICKET / STEP: 0002796:001:001 STEP DESCRIPTION: TWO (2) YEAR EXTENDED WARRANTY STATUS: COMPLETED /WARRANTY EACH 1.00 4,496.00 TWO (2) YEAR PARTS & LABOR ONSITE WARRANTY SERVICES FOR 7TH STREET GARAGE LIGHTNING SURGES & ACTS OF GOD ARE NOT COVERED BY WARRANTY. /WARRANTY EACH 1.00 3,478.00 TWO (2) YEAR PARTS & LABOR ONSITE WARRANTY SERVICES FOR 12TH STREET GARAGE LIGHTNING SURGES & ACTS OF GOD ARE NOT COVERED BY WARRANTY. /WARRANTY EACH 1.00 3,569.00 TWO (2) YEAR PARTS & LABOR ONSITE WARRANTY SERVICES FOR 13TH STREET GARAGE LIGHTNING SURGES & ACTS OF GOD ARE NOT COVERED BY WARRANTY. /WARRANTY EACH 1.00 6,332.00 TWO (2) YEAR PARTS & LABOR ONSITE WARRANTY SERVICES FOR 16TH STREET GARAGE LIGHTNING SURGES & ACTS OF GOD ARE NOT COVERED BY WARRANTY. /WARRANTY EACH 1.00 5,244.00 TWO (2) YEAR PARTS & LABOR ONSITE WARRANTY SERVICES FOR 42ND STREET GARAGE LIGHTNING SURGES & ACTS OF GOD ARE NOT COVERED BY WARRANTY. 4,496.00 3,478.00 3,569.00 6,332.00 5,244.00 gisnet TELECOM 2842 NW 79 AVE - Miami, FL 33122 TEL: 305-265-0447 - FAX: 305-265-0872 http://www.gisnet.net support@gisnet.net CUSTOMER NUMBER: ORDER NUMBER: ORDER DATE: ACCOUNT CONTACT: CITYMB 0002796 11/7/2007 CUSTOMER PO#: SOLD TO: City of Miami Beach 1100 Washington Ave 4TH Floor MIAMI BEACH, FL 33139 ITEM NUMBER UNIT QUOTE PAGE: 2 SALES REP: Felix Veloso TERMS: NET 10 ORDER CONTACT: SHIP TO: City of Miami Beach 1100 Washington Ave 4TH Floor MIAMI BEACH, FL 33139 QUANTITY PRICE AMOUNT TERMS AND CONDITIONS This Agreement will become effective on the date signed by GISNET's authorized representative below and continue until terminated by either GISNET or Client at any time, with or without cause, by providing at east thirty (30) days prior written notice to the other party. All fees and expenses related to services provided under this Agreement must be paid by Client to GISNET, in full, prior to termination. This Agreement will not become effective or binding upon GISNET unless signed and dated by a GISNET authorized representative where indicated below. GISNET shall be solely responsible for staffing decisions with respect to its personnel and the performance of services. GISNET reserves the right to assign, re -assign and substitute its personnel with personnel with comparable qualifications at any time during the term of this Agreement. During the term, and for a period of five (5) years after the termination, of this Agreement, GISNET will not divulge to others any confidential information disclosed by Client to GISNET in writing and clearly marked as confidential ("Confidential Information"). Confidential Information will not include any information that is: as of the time of its disclosure, or thereafter becomes, part of the public domain through a source other than GISNET; made known to GISNET by a third person who is not subject to any confidentiality obligation and does not impose any confidentiality obligation on GISNET with respect to such information; independently developed by personnel of GISNET without knowledge of the Confidential Information; or • Required to be disclosed pursuant to governmental authority, law, regulation, duly authorized subpoena or court order, where upon GISNET will provide written notice to Client prior to such disclosure. All notices and other communications required or desired to be given pursuant to this Agreement will be given in writing and will be deemed duly given (i) upon personal delivery; (ii) on the third day after mailing if sent by registered or certified mail, postage prepaid, return receipt requested; (iii) on the day after mailing if sent by a nationally recognized overnight delivery service which maintains records of the time, place and recipient of delivery; or (iv) upon receipt of a confirmed transmission, if sent by telex or facsimile transmission, and in each case if addressed as follows: 2842 NW 79 Ave Doral, Florida 33122 , Fax: (305) 265-0872. GISNET and Client acknowledge and agree that the Additional Terms and Conditions available for review at http://www.gisnet.net/exhibita.cfm as Exhibit A are incorporated into and made a part of this Agreement. Acknowledged and agreed by Client By: Name: Title: Date: Authorized GISNET Representative By: Name: Title: Date: PLEASE SIGN AND FAX BACK TO 305-265-0872 OR EMAIL TO ORDERS@GISNET.NET TO EXECUTE YOUR ORDER. Net Order: Less Discount: Freight: Sales Tax: Order Total: 23,119.00 0.00 0.00 0.00 23,119.00